From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_0941 [new locus tag: SAUSA300_RS05055 ]
  • pan locus tag?: SAUPAN003237000
  • symbol: SAUSA300_0941
  • pan gene symbol?:
  • synonym:
  • product: putative ferrichrome ABC transporter

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_0941 [new locus tag: SAUSA300_RS05055 ]
  • symbol: SAUSA300_0941
  • product: putative ferrichrome ABC transporter
  • replicon: chromosome
  • strand: +
  • coordinates: 1029841..1030704
  • length: 864
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    ATGACGACAATAAAAGATGAATTAGGAACTGAAAAAATTAAGAAAAATCCTAAACGTGTT
    GTTGTATTAGAATATAGTTTTGCTGATTATTTAGCAGCATTAGATATGAAACCTGTTGGT
    ATTGCAGATGATGGCAGCACTAAAAATATAACAAAGTCAGTAAGAGATAAGATTGGGGCA
    TATGAATCGGTTGGATCTAGACCGCAACCGAATATGGAAGTGATAAGTAAATTAAAACCG
    GATTTGATCATTGCAGATGTTAGCAGACATAAGAAAATCAAATCAGAATTGAGCAAAATT
    GCTCCGACAATCATGTTAGTTAGCGGTACGGGAGATTATAATGCAAATATTGAAGCATTT
    AAAACAGTCGCTAAAGCAGTAGGCAAAGAGAAAGAAGGCGAGAAGCGTCTGGAAAAGCAT
    GATAAAATATTAGCGGAGATTAGAAAGAAAATTGAACAGAGTACGTTAAAATCTGCATTT
    GCATTCGGTATCTCAAGAGCAGGTATGTTTATTAATAATGAAGATACATTTATGGGACAA
    TTCTTAATTAAAATGGGTATTCAACCTGAAGTCACAAAAGACAAAACTACGCATGTTGGT
    GAACGCAAGGGTGGTCCTTATATATATTTAAATAATGAAGAACTTGCCAATATCAATCCA
    AAAGTTATGATTTTAGCCACTGACGGAAAAACGGACAAAAATAGAACGAAATTCATTGAT
    CCTGCAGTTTGGAAATCATTAAAAGCTGTGAAAGATAACAAAGTTTATGACGTTGACCGA
    AATAAGTGGTTGAAATCAAGGGGGATTATCGCAAGTGAAAGTATGGCAGAAGATTTAGAA
    AAAATTGCAGAAAAAGCAAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    864

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAUSA300_0941 [new locus tag: SAUSA300_RS05055 ]
  • symbol: SAUSA300_0941
  • description: putative ferrichrome ABC transporter
  • length: 287
  • theoretical pI: 10.128
  • theoretical MW: 32034.9
  • GRAVY: -0.510105

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    heme ABC transporter, heme-binding protein isdE (TIGR03659; HMM-score: 81.5)
    putative ABC transporter PGF-CTERM-modified substrate-binding protein (TIGR04281; HMM-score: 30.5)
  • TheSEED:  
    Iron acquisition and metabolismIron acquisition and metabolism - no subcategoryHeme, hemin uptake and utilization systems in GramPositives Heme ABC type transporter HtsABC, heme-binding protein 
    Stress ResponseStress Response - no subcategoryFlavohaemoglobin Heme ABC type transporter HtsABC, heme-binding protein 
  • PFAM:
    Chelatase (CL0043) Peripla_BP_2; Periplasmic binding protein (PF01497; HMM-score: 116.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.17
    • Cytoplasmic Membrane Score: 9.51
    • Cellwall Score: 0.16
    • Extracellular Score: 0.15
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.141
    • Ymax_pos: 43
    • Cmax: 0.122
    • Cmax_pos: 43
    • Smax: 0.268
    • Smax_pos: 7
    • Smean: 0.14
    • D: 0.141
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MTTIKDELGTEKIKKNPKRVVVLEYSFADYLAALDMKPVGIADDGSTKNITKSVRDKIGAYESVGSRPQPNMEVISKLKPDLIIADVSRHKKIKSELSKIAPTIMLVSGTGDYNANIEAFKTVAKAVGKEKEGEKRLEKHDKILAEIRKKIEQSTLKSAFAFGISRAGMFINNEDTFMGQFLIKMGIQPEVTKDKTTHVGERKGGPYIYLNNEELANINPKVMILATDGKTDKNRTKFIDPAVWKSLKAVKDNKVYDVDRNKWLKSRGIIASESMAEDLEKIAEKAK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SAUSA300_0941 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]