From AureoWiki
Jump to: navigation, search

NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS00690 [old locus tag: SA0107 ]
  • pan locus tag?: SAUPAN000909000
  • symbol: SA_RS00690
  • pan gene symbol?: spa
  • synonym:
  • product: immunoglobulin G-binding protein A

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS00690 [old locus tag: SA0107 ]
  • symbol: SA_RS00690
  • product: immunoglobulin G-binding protein A
  • replicon: chromosome
  • strand: -
  • coordinates: 122649..124001
  • length: 1353
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002745 (122649..124001) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    1201
    1261
    1321
    TTGAAAAAGAAAAACATTTATTCAATTCGTAAACTAGGTGTAGGTATTGCATCTGTAACT
    TTAGGTACATTACTTATATCTGGTGGCGTAACACCTGCTGCAAATGCTGCGCAACACGAT
    GAAGCTCAACAAAATGCTTTTTATCAAGTGTTAAATATGCCTAACTTAAACGCTGATCAA
    CGTAATGGTTTTATCCAAAGCCTTAAAGATGATCCAAGCCAAAGTGCTAACGTTTTAGGT
    GAAGCTCAAAAACTTAATGACTCTCAAGCTCCAAAAGCTGATGCGCAACAAAATAACTTC
    AACAAAGATCAACAAAGCGCCTTCTATGAAATCTTGAACATGCCTAACTTAAACGAAGCG
    CAACGTAACGGCTTCATTCAAAGTCTTAAAGACGACCCAAGCCAAAGCACTAATGTTTTA
    GGTGAAGCTAAAAAATTAAACGAATCTCAAGCACCGAAAGCTGATAACAATTTCAACAAA
    GAACAACAAAATGCTTTCTATGAAATCTTGAATATGCCTAACTTAAACGAAGAACAACGC
    AATGGTTTCATCCAAAGCTTAAAAGATGACCCAAGCCAAAGTGCTAACCTATTGTCAGAA
    GCTAAAAAGTTAAATGAATCTCAAGCACCGAAAGCGGATAACAAATTCAACAAAGAACAA
    CAAAATGCTTTCTATGAAATCTTACATTTACCTAACTTAAACGAAGAACAACGTAACGGC
    TTCATCCAAAGCCTTAAAGACGATCCTTCAGTGAGCAAAGAAATTTTAGCAGAAGCTAAA
    AAGCTAAACGATGCTCAAGCACCAAAAGAGGAAGACAACAAAAAACCTGGTAAAGAAGAC
    GGCAACAAACCTGGCAAAGAAGACGGCAACAAGCCTGGTAAAGAAGACAACAAAAAACCT
    GGTAAAGAAGACGGCAACAAGCCTGGTAAAGAAGACAACAACAAACCTGGCAAAGAAGAC
    GGCAACAAGCCTGGTAAAGAAGACAACAACAAGCCTGGTAAAGAAGACGGCAACAAGCCT
    GGTAAAGAAGACGGCAACAAACCTGGTAAAGAAGACGGCAACGGAGTACATGTCGTTAAA
    CCTGGTGATACAGTAAATGACATTGCAAAAGCAAACGGCACTACTGCTGACAAAATTGCT
    GCAGATAACAAATTAGCTGATAAAAACATGATCAAACCTGGTCAAGAACTTGTTGTTGAT
    AAGAAGCAACCAGCAAACCATGCAGATGCTAACAAAGCTCAAGCATTACCAGAAACTGGT
    GAAGAAAATCCATTCATCGGTACAACTGTATTTGGTGGATTATCATTAGCCTTAGGTGCA
    GCGTTATTAGCTGGACGTCGTCGCGAACTATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1200
    1260
    1320
    1353

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA_RS00690 [old locus tag: SA0107 ]
  • symbol: SA_RS00690
  • description: immunoglobulin G-binding protein A
  • length: 450
  • theoretical pI: 5.46895
  • theoretical MW: 48872.5
  • GRAVY: -1.13111

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    gram-positive signal peptide, YSIRK family (TIGR01168; HMM-score: 34.8)
    Cell structureCell envelopeOtherLPXTG cell wall anchor domain (TIGR01167; HMM-score: 19.6)
    Cellular processesCellular processesSporulation and germinationspore coat assembly protein SafA (TIGR02899; HMM-score: 17.8)
  • TheSEED:
  • PFAM:
    B_GA (CL0598) B; B domain (PF02216; HMM-score: 380.3)
    LysM (CL0187) LysM; LysM domain (PF01476; HMM-score: 48.9)
    B_GA (CL0598) GA; GA module (PF01468; HMM-score: 45.8)
    no clan definedGram_pos_anchor; LPXTG cell wall anchor motif (PF00746; HMM-score: 38.6)
    YSIRK_signal; YSIRK type signal peptide (PF04650; HMM-score: 38.6)
    Octapeptide; Octapeptide repeat (PF03373; HMM-score: 30.8)
    Dim_A_B_barrel (CL0032) DUF3291; Domain of unknown function (DUF3291) (PF11695; HMM-score: 15.8)
    no clan definedIFT43; Intraflagellar transport protein 43 (PF15305; HMM-score: 14.7)
    NTS_2; N-terminal segments of P. falciparum erythrocyte membrane protein (PF15448; HMM-score: 10.2)
    DUF148; Domain of unknown function DUF148 (PF02520; HMM-score: 8.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:
    SA_RS02960elongation factor Tu  [1] (data from MRSA252)
    SA_RS08505aldehyde dehydrogenase  [1] (data from MRSA252)
    SA_RS08625universal stress protein UspA  [1] (data from MRSA252)
    SA_RS1168030S ribosomal protein S5  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: Cellwall
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 9.98
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • LocateP:
  • SignalP: Signal peptide length 37 aa
    • Ymax: 0.746
    • Ymax_pos: 37
    • Cmax: 0.674
    • Cmax_pos: 37
    • Smax: 0.91
    • Smax_pos: 27
    • Smean: 0.78
    • D: 0.759
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

  • GI: 446651419 NCBI
  • RefSeq: WP_000728765 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKKKNIYSIRKLGVGIASVTLGTLLISGGVTPAANAAQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNNFNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLSEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPKEEDNKKPGKEDGNKPGKEDGNKPGKEDNKKPGKEDGNKPGKEDNNKPGKEDGNKPGKEDNNKPGKEDGNKPGKEDGNKPGKEDGNGVHVVKPGDTVNDIAKANGTTADKIAADNKLADKNMIKPGQELVVDKKQPANHADANKAQALPETGEENPFIGTTVFGGLSLALGAALLAGRRREL

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA_RS00690 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.0 1.1 1.2 1.3 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]