From AureoWiki
Jump to: navigation, search

NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS12400 [old locus tag: SA2160 ]
  • pan locus tag?: SAUPAN005886000
  • symbol: SA_RS12400
  • pan gene symbol?:
  • synonym:
  • product: quinone oxidoreductase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS12400 [old locus tag: SA2160 ]
  • symbol: SA_RS12400
  • product: quinone oxidoreductase
  • replicon: chromosome
  • strand: +
  • coordinates: 2427271..2428317
  • length: 1047
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002745 (2427271..2428317) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    ATGGCCGTATTTTCAAAAGAGAAAAAGAGAGGATGTATCGTTGTGATAGAAACATTTAAA
    GCGTTTGTAATTGATAAAGATGAGAGCGGTAAAGTGACACCAACTTTCAAACAATTATCG
    CCTACTGATTTACCTAAAGGAGATGTGCTGATTAAAGTACATTACTCTGGTATAAATTAT
    AAAGATGCTTTAGCGACTCAAGATCATAATGCAGTCGTAAAATCGTATCCTATGATTCCA
    GGAATAGATTTAGCTGGAACAATTGTTGAATCCGAAGCACCAGGCTTTGAAAAAGGAGAA
    CAAGTAATTGTAACGAGTTATGACCTAGGTGTTAGCCATTATGGCGGTTTTAGTGAATAT
    GCGCGTGTAAAATCAGAATGGATTATCAAGCTTCCTGATACTTTAACATTAGAAGAATCA
    ATGATATATGGCACAGCTGGTTATACTGCCGGTTTAGCAATTGAAAGACTTGAAAAAGTT
    GGAATGAATATTGAAGATGGTCCTGTACTCGTTCGCGGTGCTTCAGGTGGTGTCGGTACT
    TTAGCAGTACTCATGCTTAATGAACTTGGTTATAAAGTTATCGCAAGTACAGGTAAACAA
    GATGTTAGCGATCAATTACTTGAACTTGGTGCCAAAGAAGTTATCGATCGACTTCCTGTT
    GAAGATGATCATAAAAAGCCACTCGCATCATCAACTTGGCAAGCTTGTGTAGACCCTGTT
    GGTGGCGAAGGTATTAATTATGTTACAAAACGTTTAAATCATAGTGGATCAATTGCAGTT
    ATTGGTATGACTGCCGGCAATACTTATACTAATTCTGTATTCCCTCACATTTTAAGAGGC
    GTAAACATTTTAGGAATTGACTCAGTATTTACTGCTATGAAATTAAGACAGCGCGTTTGG
    CGTCGTCTCGCAAAAGATTTAAAGCCTGAAAATTTACATGAGATCAAGCAAGTTATTACA
    TTTGATGAACTTCCAGAACAACTTAACAAAGTAATTAATCATGAAAATAAAGGCCGCATT
    GTTATCGATTTCGGTGTAGATAAATAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1047

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA_RS12400 [old locus tag: SA2160 ]
  • symbol: SA_RS12400
  • description: quinone oxidoreductase
  • length: 348
  • theoretical pI: 6.32425
  • theoretical MW: 38098.5
  • GRAVY: -0.112931

Function[edit source | edit]

  • TIGRFAM:
    Unknown functionEnzymes of unknown specificityputative quinone oxidoreductase, YhdH/YhfP family (TIGR02823; HMM-score: 451.8)
    and 8 more
    Unknown functionEnzymes of unknown specificityputative NAD(P)H quinone oxidoreductase, PIG3 family (TIGR02824; HMM-score: 95.6)
    crotonyl-CoA carboxylase/reductase (TIGR01751; EC 1.3.1.85; HMM-score: 58.8)
    MetabolismEnergy metabolismFermentationzinc-binding alcohol dehydrogenase family protein (TIGR02817; HMM-score: 38.4)
    leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase (TIGR02825; EC 1.3.1.48,1.3.1.74; HMM-score: 35.3)
    Unknown functionEnzymes of unknown specificityNDMA-dependent alcohol dehydrogenase, Rxyl_3153 family (TIGR03989; EC 1.1.99.36; HMM-score: 30.6)
    MetabolismEnergy metabolismAmino acids and aminesL-threonine 3-dehydrogenase (TIGR00692; EC 1.1.1.103; HMM-score: 26.7)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersChlorophyll and bacteriochlorphyllchlorophyll synthesis pathway protein BchC (TIGR01202; HMM-score: 25)
    6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase (TIGR03201; EC 1.1.1.-; HMM-score: 12.7)
  • TheSEED:
  • PFAM:
    NADP_Rossmann (CL0063) ADH_zinc_N; Zinc-binding dehydrogenase (PF00107; HMM-score: 47.1)
    and 4 more
    GroES (CL0296) ADH_N; Alcohol dehydrogenase GroES-like domain (PF08240; HMM-score: 34.3)
    NADP_Rossmann (CL0063) ADH_zinc_N_2; Zinc-binding dehydrogenase (PF13602; HMM-score: 16.5)
    GroES (CL0296) ADH_N_2; N-terminal domain of oxidoreductase (PF16884; HMM-score: 13.5)
    NADP_Rossmann (CL0063) ELFV_dehydrog; Glutamate/Leucine/Phenylalanine/Valine dehydrogenase (PF00208; HMM-score: 11.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.184
    • Ymax_pos: 31
    • Cmax: 0.182
    • Cmax_pos: 31
    • Smax: 0.403
    • Smax_pos: 1
    • Smean: 0.211
    • D: 0.195
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 487708286 NCBI
  • RefSeq: WP_001792518 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MAVFSKEKKRGCIVVIETFKAFVIDKDESGKVTPTFKQLSPTDLPKGDVLIKVHYSGINYKDALATQDHNAVVKSYPMIPGIDLAGTIVESEAPGFEKGEQVIVTSYDLGVSHYGGFSEYARVKSEWIIKLPDTLTLEESMIYGTAGYTAGLAIERLEKVGMNIEDGPVLVRGASGGVGTLAVLMLNELGYKVIASTGKQDVSDQLLELGAKEVIDRLPVEDDHKKPLASSTWQACVDPVGGEGINYVTKRLNHSGSIAVIGMTAGNTYTNSVFPHILRGVNILGIDSVFTAMKLRQRVWRRLAKDLKPENLHEIKQVITFDELPEQLNKVINHENKGRIVIDFGVDK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA_RS12400 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]