From AureoWiki
Jump to navigation Jump to search

NCBI: 01-DEC-2025

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_001063 [new locus tag: EGJ38_RS05310 ]
  • pan locus tag?: SAUPAN003322000
  • symbol: EGJ38_001063
  • pan gene symbol?:
  • synonym:
  • alternate name: JSNZ_001063
  • product: XRE family transcriptional regulator

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_001063 [new locus tag: EGJ38_RS05310 ]
  • symbol: EGJ38_001063
  • product: XRE family transcriptional regulator
  • replicon: chromosome
  • strand: +
  • coordinates: 1067971..1068510
  • length: 540
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2423032 NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGAACATAGGTAATAAAATTAAAAATCTTAGAAGAATTAAAAATTTAACGCAAGAAGAA
    CTTGCTGAACGTACAGACTTATCGAAAGGCTACATTTCACAAATAGAAAGTGAACATGCC
    TCACCAAGTATGGAAACTTTCTTAAATATTATAGAGGTGTTAGGAACGACGCCAAGTGAA
    TTTTTTAAAGACAGTGAAAATGAAAAAGTATTATACAAGAAGGAAGAACAAGTTATTTAT
    GATGAGTATGATGAAGGTTATATATTAAATTGGTTAGTTTCAAAGTCAAATGAATATGAT
    ATGGAGCCATTAATATTAACTTTAAAGCCTGGAGCATCATATAAAAATTTTAATCCATCA
    GAGTCTGATACGTTTATTTATTGTATGTCAGGTCAGATAACACTTAATTTAGGCAAAGAG
    ATATATCAAGCACAAGAAGAAGACGTTTTGTATTTTAAAGCACGAGATAATCATCGTTTG
    TCAAACGAATCAAACAATGAAACACGAATACTTATTGTAGCGACAGCTTCATATTTATAG
    60
    120
    180
    240
    300
    360
    420
    480
    540


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_001063 [new locus tag: EGJ38_RS05310 ]
  • symbol: EGJ38_001063
  • description: XRE family transcriptional regulator
  • length: 179
  • theoretical pI: 4.42625
  • theoretical MW: 20745.1
  • GRAVY: -0.602235

Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions DNA interactions transcriptional regulator, y4mF family (TIGR03070; HMM-score: 41.7)
    putative allantoin catabolism protein (TIGR03214; HMM-score: 36.2)
    and 6 more
    putative zinc finger/helix-turn-helix protein, YgiT family (TIGR03830; HMM-score: 19)
    Genetic information processing Mobile and extrachromosomal element functions Other addiction module antidote protein, HigA family (TIGR02607; HMM-score: 16.6)
    Signal transduction Regulatory functions DNA interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 16.6)
    Signal transduction Regulatory functions Protein interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 16.6)
    RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 15.8)
    Hypothetical proteins Conserved TIGR00270 family protein (TIGR00270; HMM-score: 13.8)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 55.5)
    HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 46.7)
    and 12 more
    Cupin (CL0029) Cupin_2; Cupin domain (PF07883; HMM-score: 40)
    HTH (CL0123) HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 36.4)
    HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 25.7)
    Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 25.3)
    Cupin (CL0029) Pirin_C; Pirin C-terminal cupin domain (PF05726; HMM-score: 22.6)
    AraC_binding; AraC-like ligand binding domain (PF02311; HMM-score: 21)
    HTH (CL0123) HTH_25; Helix-turn-helix domain (PF13413; HMM-score: 19.4)
    no clan defined DUF896; Bacterial protein of unknown function (DUF896) (PF05979; HMM-score: 17)
    HTH (CL0123) MarR_2; MarR family (PF12802; HMM-score: 14.5)
    Cupin (CL0029) CENP-C_C; Mif2/CENP-C like (PF11699; HMM-score: 14.3)
    HTH (CL0123) HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 13.4)
    Cupin (CL0029) MannoseP_isomer; Mannose-6-phosphate isomerase C-terminal (PF01050; HMM-score: 13)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9281
    • Cytoplasmic Membrane Score: 0.0116
    • Cell wall & surface Score: 0.0002
    • Extracellular Score: 0.0601
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003694
    • TAT(Tat/SPI): 0.000577
    • LIPO(Sec/SPII): 0.000429
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2423032 NCBI
  • UniProt:

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MNIGNKIKNLRRIKNLTQEELAERTDLSKGYISQIESEHASPSMETFLNIIEVLGTTPSEFFKDSENEKVLYKKEEQVIYDEYDEGYILNWLVSKSNEYDMEPLILTLKPGASYKNFNPSESDTFIYCMSGQITLNLGKEIYQAQEEDVLYFKARDNHRLSNESNNETRILIVATASYL

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]