Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_001766 [new locus tag: EGJ38_RS08820 ]
- pan locus tag?: SAUPAN004470000
- symbol: sigS
- pan gene symbol?: sigS
- synonym:
- alternate name: JSNZ_001766
- product: RNA polymerase sigma factor SigS
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_001766 [new locus tag: EGJ38_RS08820 ]
- symbol: sigS
- product: RNA polymerase sigma factor SigS
- replicon: chromosome
- strand: +
- coordinates: 1819654..1820124
- length: 471
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2423721 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421TTGAAATTTAATGACGTATACAACAAACACCACAAAATCATACACCATCTTTTAAAAAAA
TATAATATTAGCTATAATTATGATGAGTATTATCAACTACTCTTGATAAAAATGTGGCAA
TTGAGTCAGATATATAAACCCTCAAGCAAGCAATCTTTATCCTCTTTTTTATTCACTCGA
TTAAATTTTTACCTTATCGATTTATTCAGACAACAAAATCAATTAAAAGATGTCATTTTA
TGTGAGAATAATTCACCAACATTAACTGAACAACCAACATACTTTAATGAACATGACCTT
CGTTTACAAGATATCTTCAAGCTTTTAAATCAAAGAGAAAGACTTTGGCTCAAACTATAC
CTTGAAGGATACAAGCAATTTGAAATTGCTGAAATCATGTCATTATCGCTTTCAACGATT
AAATTAATTAAGATGTCCGTTAAGCGTAGATGCCAACATAATTTTAATTAG60
120
180
240
300
360
420
471
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_001766 [new locus tag: EGJ38_RS08820 ]
- symbol: SigS
- description: RNA polymerase sigma factor SigS
- length: 156
- theoretical pI: 9.81208
- theoretical MW: 19164.2
- GRAVY: -0.483333
⊟Function[edit | edit source]
- TIGRFAM: RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 59.8)and 11 moretranscriptional regulator BotR, P-21 (TIGR03209; HMM-score: 29.4)RNA polymerase sigma factor, SigZ family (TIGR02959; HMM-score: 25.9)RNA polymerase sigma factor, FliA/WhiG family (TIGR02479; HMM-score: 23.8)RNA polymerase sigma-70 factor, Bacteroides expansion family 1 (TIGR02985; HMM-score: 22.6)RNA polymerase sigma-70 factor, TIGR02954 family (TIGR02954; HMM-score: 16.6)RNA polymerase sigma factor, TIGR02999 family (TIGR02999; HMM-score: 15)LuxR family transcriptional regulatory, chaperone HchA-associated (TIGR03541; HMM-score: 14.9)Cellular processes Sporulation and germination RNA polymerase sigma-G factor (TIGR02850; HMM-score: 12.3)Transcription Transcription factors RNA polymerase sigma-G factor (TIGR02850; HMM-score: 12.3)RNA polymerase sigma-70 factor, sigma-E family (TIGR02983; HMM-score: 11.9)RNA polymerase sigma-B factor (TIGR02941; HMM-score: 11.2)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: HTH (CL0123) Sigma70_r2; Sigma-70 region 2 (PF04542; HMM-score: 31.3)and 8 moreSigma70_r4_2; Sigma-70, region 4 (PF08281; HMM-score: 21.9)GerE; Bacterial regulatory proteins, luxR family (PF00196; HMM-score: 21.2)Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 19.7)HTH_7; Helix-turn-helix domain of resolvase (PF02796; HMM-score: 13.8)HTH_40; Helix-turn-helix domain (PF14493; HMM-score: 13.8)Terminase_5; Putative ATPase subunit of terminase (gpP-like) (PF06056; HMM-score: 13.1)TerS_N; Phage G20C small terminase, N-terminal domain (PF21434; HMM-score: 12.8)HTH_23; Homeodomain-like domain (PF13384; HMM-score: 12.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.6676
- Cytoplasmic Membrane Score: 0.2287
- Cell wall & surface Score: 0.0021
- Extracellular Score: 0.1016
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003706
- TAT(Tat/SPI): 0.000167
- LIPO(Sec/SPII): 0.000947
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2423721 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MKFNDVYNKHHKIIHHLLKKYNISYNYDEYYQLLLIKMWQLSQIYKPSSKQSLSSFLFTRLNFYLIDLFRQQNQLKDVILCENNSPTLTEQPTYFNEHDLRLQDIFKLLNQRERLWLKLYLEGYKQFEIAEIMSLSLSTIKLIKMSVKRRCQHNFN
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]
Lindsey N Shaw, Catharina Lindholm, Tomasz K Prajsnar, Halie K Miller, Melanie C Brown, Ewa Golonka, George C Stewart, Andrej Tarkowski, Jan Potempa
Identification and characterization of sigma, a novel component of the Staphylococcus aureus stress and virulence responses.
PLoS One: 2008, 3(12);e3844
[PubMed:19050758] [WorldCat.org] [DOI] (I p)