From AureoWiki
Jump to navigation Jump to search

NCBI: 22-FEB-2026

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_RS08820 [old locus tag: EGJ38_001766 ]
  • pan locus tag?: SAUPAN004470000
  • symbol: sigS
  • pan gene symbol?: sigS
  • synonym:
  • product: RNA polymerase sigma factor SigS

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_RS08820 [old locus tag: EGJ38_001766 ]
  • symbol: sigS
  • product: RNA polymerase sigma factor SigS
  • replicon: chromosome
  • strand: +
  • coordinates: 1819654..1820124
  • length: 471
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NZ_CM129921 (1819654..1820124) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    TTGAAATTTAATGACGTATACAACAAACACCACAAAATCATACACCATCTTTTAAAAAAA
    TATAATATTAGCTATAATTATGATGAGTATTATCAACTACTCTTGATAAAAATGTGGCAA
    TTGAGTCAGATATATAAACCCTCAAGCAAGCAATCTTTATCCTCTTTTTTATTCACTCGA
    TTAAATTTTTACCTTATCGATTTATTCAGACAACAAAATCAATTAAAAGATGTCATTTTA
    TGTGAGAATAATTCACCAACATTAACTGAACAACCAACATACTTTAATGAACATGACCTT
    CGTTTACAAGATATCTTCAAGCTTTTAAATCAAAGAGAAAGACTTTGGCTCAAACTATAC
    CTTGAAGGATACAAGCAATTTGAAATTGCTGAAATCATGTCATTATCGCTTTCAACGATT
    AAATTAATTAAGATGTCCGTTAAGCGTAGATGCCAACATAATTTTAATTAG
    60
    120
    180
    240
    300
    360
    420
    471


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_RS08820 [old locus tag: EGJ38_001766 ]
  • symbol: SigS
  • description: RNA polymerase sigma factor SigS
  • length: 156
  • theoretical pI: 9.81208
  • theoretical MW: 19164.2
  • GRAVY: -0.483333

Function[edit | edit source]

  • TIGRFAM:
    RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 59.8)
    and 11 more
    transcriptional regulator BotR, P-21 (TIGR03209; HMM-score: 29.4)
    RNA polymerase sigma factor, SigZ family (TIGR02959; HMM-score: 25.9)
    RNA polymerase sigma factor, FliA/WhiG family (TIGR02479; HMM-score: 23.8)
    RNA polymerase sigma-70 factor, Bacteroides expansion family 1 (TIGR02985; HMM-score: 22.6)
    RNA polymerase sigma-70 factor, TIGR02954 family (TIGR02954; HMM-score: 16.6)
    RNA polymerase sigma factor, TIGR02999 family (TIGR02999; HMM-score: 15)
    LuxR family transcriptional regulatory, chaperone HchA-associated (TIGR03541; HMM-score: 14.9)
    Cellular processes Cellular processes Sporulation and germination RNA polymerase sigma-G factor (TIGR02850; HMM-score: 12.3)
    Genetic information processing Transcription Transcription factors RNA polymerase sigma-G factor (TIGR02850; HMM-score: 12.3)
    RNA polymerase sigma-70 factor, sigma-E family (TIGR02983; HMM-score: 11.9)
    RNA polymerase sigma-B factor (TIGR02941; HMM-score: 11.2)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    HTH (CL0123) Sigma70_r2; Sigma-70 region 2 (PF04542; HMM-score: 31.3)
    and 8 more
    Sigma70_r4_2; Sigma-70, region 4 (PF08281; HMM-score: 21.9)
    GerE; Bacterial regulatory proteins, luxR family (PF00196; HMM-score: 21.2)
    Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 19.7)
    HTH_7; Helix-turn-helix domain of resolvase (PF02796; HMM-score: 13.8)
    HTH_40; Helix-turn-helix domain (PF14493; HMM-score: 13.8)
    Terminase_5; Putative ATPase subunit of terminase (gpP-like) (PF06056; HMM-score: 13.1)
    TerS_N; Phage G20C small terminase, N-terminal domain (PF21434; HMM-score: 12.8)
    HTH_23; Homeodomain-like domain (PF13384; HMM-score: 12.5)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.6676
    • Cytoplasmic Membrane Score: 0.2287
    • Cell wall & surface Score: 0.0021
    • Extracellular Score: 0.1016
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003706
    • TAT(Tat/SPI): 0.000167
    • LIPO(Sec/SPII): 0.000947
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: WP_000671053 NCBI
  • UniProt:

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MKFNDVYNKHHKIIHHLLKKYNISYNYDEYYQLLLIKMWQLSQIYKPSSKQSLSSFLFTRLNFYLIDLFRQQNQLKDVILCENNSPTLTEQPTYFNEHDLRLQDIFKLLNQRERLWLKLYLEGYKQFEIAEIMSLSLSTIKLIKMSVKRRCQHNFN

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]