Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_2522 [new locus tag: NWMN_RS14495 ]
- pan locus tag?: SAUPAN006336000
- symbol: NWMN_2522
- pan gene symbol?: braD
- synonym: nsaA
- product: ABC transporter ATP-binding protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_2522 [new locus tag: NWMN_RS14495 ]
- symbol: NWMN_2522
- product: ABC transporter ATP-binding protein
- replicon: chromosome
- strand: -
- coordinates: 2774319..2775074
- length: 756
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5331572 NCBI
- RefSeq: YP_001333556 NCBI
- BioCyc:
- MicrobesOnline: 3708124 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721ATGTTGCTAGAAGTGAAACATGTAAAAAAGGTTTATGGTAAAGGTTTGAATGCTACGACA
GCACTTAATCAAATGAATTTATCAGTTGGAGCTGGTGAATTTGTTGCAATTATGGGTGAG
TCTGGGTCAGGGAAGTCTACACTACTAAATTTAATTGCTTCTTTTGATGGACTAACTGAA
GGTGACATTATTGTGGATGGCGCACATTTAAATAATATGAAAAATAAAAGTAAAGCATTG
TATCGTCAACAAATGGTAGGTTTTGTTTTTCAAGATTTTAATCTTTTACCAACAATGACG
AATAAAGAAAATATAATGATGCCATTAATTTTAGCTGGTGCTAAACGAAAAGATATAGAA
CAAAGGGTACATCAGTTGGCAGTACAATTACATTTAGAGGGATTCTTAAACAAGTATCCT
TCTGAAATCTCTGGGGGTCAGAAGCAACGCATTGCCATTGCACGTGCATTAGTTACTAAG
CCGACGATTTTACTAGCCGATGAACCTACAGGTGCACTTGATTCAAAAACATCAAAGGCA
TTGATGATGTTATTTCAAGAGATTCATCAATTGGAACAGACAATTTTAATGGTAACTCAT
TCAAATATCGATGCGTCTTATGCAGAGCGAGTCATTTTTATTAAAGATGGGCGTCTATAT
CATGAAATATATCGTGGTGAAGAAAGTCAATTAGCTTTTCAACAACGAATAACAGATAGC
TTAGCACTTGTGAATGGAGGAAGTGTCAATATATGA60
120
180
240
300
360
420
480
540
600
660
720
756
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_2522 [new locus tag: NWMN_RS14495 ]
- symbol: NWMN_2522
- description: ABC transporter ATP-binding protein
- length: 251
- theoretical pI: 8.7789
- theoretical MW: 27730
- GRAVY: -0.0585657
⊟Function[edit | edit source]
- TIGRFAM: Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 211.5)Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 205.8)Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 203.2)Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 203.2)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 190.9)D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 173.5)and 81 moreTransport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 168.7)Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 167)Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 163)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 157.3)Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 155)Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 153)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 152.4)Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 150.9)ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 148.2)Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 135.8)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 135.5)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 135.5)Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 134.8)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 134.1)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 133.3)Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 132.3)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 132.3)Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 132.1)Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 132.1)Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 124.7)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 121.8)Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 120.8)Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 118.8)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 117.6)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 114.5)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 113.8)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 112.9)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 112.9)Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 111.5)Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 110.5)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 109.5)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 108.9)Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 107.4)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 105.3)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 105.3)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 105.1)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 101.5)Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 94)Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 94)Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 94)Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 93.8)Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 93.8)proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 93.4)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 92)Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 92)Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 89.3)Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 86.5)Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 86.4)Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 84.5)gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 83.8)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 83.7)lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 83.1)Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 81.7)Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 79.8)Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 79.8)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 67.8)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 67)Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 63.7)Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 58.4)Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 58.4)Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 52.8)Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 45)Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 43.9)DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 39.5)Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 36.2)Cellular processes Chemotaxis and motility flagellar protein export ATPase FliI (TIGR03497; EC 3.6.3.14; HMM-score: 16.8)Cellular processes Chemotaxis and motility flagellar protein export ATPase FliI (TIGR03496; EC 3.6.3.14; HMM-score: 16.3)KaiC domain protein, PAE1156 family (TIGR03881; HMM-score: 16.3)Unknown function General small GTP-binding protein domain (TIGR00231; HMM-score: 14.8)Biosynthesis of cofactors, prosthetic groups, and carriers Pantothenate and coenzyme A dephospho-CoA kinase (TIGR00152; EC 2.7.1.24; HMM-score: 14.7)Cellular processes Pathogenesis type III secretion apparatus H+-transporting two-sector ATPase (TIGR02546; EC 3.6.3.14; HMM-score: 14.5)Protein fate Protein and peptide secretion and trafficking type III secretion apparatus H+-transporting two-sector ATPase (TIGR02546; EC 3.6.3.14; HMM-score: 14.5)DNA metabolism DNA replication, recombination, and repair DnaA regulatory inactivator Hda (TIGR03420; HMM-score: 14.3)Central intermediary metabolism Phosphorus compounds phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN (TIGR02322; HMM-score: 14.1)type IV secretion/conjugal transfer ATPase, VirB4 family (TIGR00929; HMM-score: 13.8)Protein synthesis Other GTP-binding protein Era (TIGR00436; HMM-score: 13.6)Protein synthesis Translation factors ribosome small subunit-dependent GTPase A (TIGR00157; EC 3.6.-.-; HMM-score: 12.6)Purines, pyrimidines, nucleosides, and nucleotides Salvage of nucleosides and nucleotides uridine kinase (TIGR00235; EC 2.7.1.48; HMM-score: 12.6)Protein synthesis Other ribosome biogenesis GTP-binding protein YsxC (TIGR03598; HMM-score: 12.6)Protein synthesis Other ribosome-associated GTPase EngA (TIGR03594; HMM-score: 12.2)Energy metabolism ATP-proton motive force interconversion ATPase, FliI/YscN family (TIGR01026; EC 3.6.3.14; HMM-score: 11.9)
- TheSEED :
- ABC transporter-like sensor ATP-binding protein SAV2623
- PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 125.8)and 22 moreSMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 25.4)AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 22.2)Dynamin_N; Dynamin family (PF00350; HMM-score: 21.5)RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 20.4)AAA_22; AAA domain (PF13401; HMM-score: 19.6)AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 19.3)AAA_16; AAA ATPase domain (PF13191; HMM-score: 18.8)NTPase_1; NTPase (PF03266; HMM-score: 15.9)MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 15.8)nSTAND1; Novel STAND NTPase 1 (PF20703; HMM-score: 15.4)AAA_23; AAA domain (PF13476; HMM-score: 15.3)nSTAND3; Novel STAND NTPase 3 (PF20720; HMM-score: 14.8)NACHT; NACHT domain (PF05729; HMM-score: 14.6)AAA_18; AAA domain (PF13238; HMM-score: 14.4)Sigma54_activ_2; Sigma-54 interaction domain (PF14532; HMM-score: 14.1)AAA_25; AAA domain (PF13481; HMM-score: 13.7)AAA_13; AAA domain (PF13166; HMM-score: 13.4)ATP-synt_ab; ATP synthase alpha/beta family, nucleotide-binding domain (PF00006; HMM-score: 12.8)DUF87; Helicase HerA, central domain (PF01935; HMM-score: 12.7)NB-ARC; NB-ARC domain (PF00931; HMM-score: 11.8)PMD-like (CL0874) DUF7745; Domain of unknown function (DUF7745) (PF24924; HMM-score: 11.3)P-loop_NTPase (CL0023) DO-GTPase2; Double-GTPase 2 (PF19993; HMM-score: 11.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.01
- Cytoplasmic Membrane Score: 9.99
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 0
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.1851
- Cytoplasmic Membrane Score: 0.8111
- Cell wall & surface Score: 0.0004
- Extracellular Score: 0.0034
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.018187
- TAT(Tat/SPI): 0.001433
- LIPO(Sec/SPII): 0.002039
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MLLEVKHVKKVYGKGLNATTALNQMNLSVGAGEFVAIMGESGSGKSTLLNLIASFDGLTEGDIIVDGAHLNNMKNKSKALYRQQMVGFVFQDFNLLPTMTNKENIMMPLILAGAKRKDIEQRVHQLAVQLHLEGFLNKYPSEISGGQKQRIAIARALVTKPTILLADEPTGALDSKTSKALMMLFQEIHQLEQTILMVTHSNIDASYAERVIFIKDGRLYHEIYRGEESQLAFQQRITDSLALVNGGSVNI
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
NWMN_2131 (adk) adenylate kinase [1] (data from MRSA252) NWMN_1587 (citC) isocitrate dehydrogenase [1] (data from MRSA252) NWMN_1625 (fhs) formate--tetrahydrofolate ligase [1] (data from MRSA252) NWMN_0932 (folD) bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase [1] (data from MRSA252) NWMN_0509 (fus) elongation factor G [1] (data from MRSA252) NWMN_1580 (gapB) glyceraldehyde 3-phosphate dehydrogenase 2 [1] (data from MRSA252) NWMN_1838 (gatA) aspartyl/glutamyl-tRNA amidotransferase subunit A [1] (data from MRSA252) NWMN_1837 (gatB) aspartyl/glutamyl-tRNA amidotransferase subunit B [1] (data from MRSA252) NWMN_1468 (glyS) glycyl-tRNA synthetase [1] (data from MRSA252) NWMN_1937 (groEL) chaperonin GroEL [1] (data from MRSA252) NWMN_0961 (pdhC) branched-chain alpha-keto acid dehydrogenase subunit E2 [1] (data from MRSA252) NWMN_0962 (pdhD) dihydrolipoamide dehydrogenase [1] (data from MRSA252) NWMN_0959 (phdA) pyruvate dehydrogenase E1 component, alpha subunit [1] (data from MRSA252) NWMN_1592 (pykA) pyruvate kinase [1] (data from MRSA252) NWMN_0500 (rplA) 50S ribosomal protein L1 [1] (data from MRSA252) NWMN_2151 (rplD) 50S ribosomal protein L4 [1] (data from MRSA252) NWMN_0501 (rplJ) 50S ribosomal protein L10 [1] (data from MRSA252) NWMN_1166 (rpsB) 30S ribosomal protein S2 [1] (data from MRSA252) NWMN_2146 (rpsC) 30S ribosomal protein S3 [1] (data from MRSA252) NWMN_2135 (rpsE) 30S ribosomal protein S5 [1] (data from MRSA252) NWMN_2153 (rpsJ) 30S ribosomal protein S10 [1] (data from MRSA252) NWMN_1325 (sucB) dihydrolipoamide succinyltransferase [1] (data from MRSA252) NWMN_0510 (tufA) elongation factor Tu [1] (data from MRSA252) NWMN_0601 hypothetical protein [1] (data from MRSA252) NWMN_0641 hypothetical protein [1] (data from MRSA252) NWMN_0721 sigma 54 modulation protein [1] (data from MRSA252) NWMN_0811 hypothetical protein [1] (data from MRSA252) NWMN_0839 fumarylacetoacetate hydrolase family protein [1] (data from MRSA252) NWMN_0881 enoyl-(acyl carrier protein) reductase [1] (data from MRSA252) NWMN_1604 universal stress protein family protein [1] (data from MRSA252) NWMN_2086 alkaline shock protein 23 [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)