PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 26-AUG-2013

⊟Summary

• organism: Staphylococcus aureus N315
• locus tag: SA0271 [new locus tag: SA_RS01590 ]
• pan locus tag^?: SAUPAN001175000
• symbol: SA0271
• pan gene symbol^?: esxA
• synonym:
• product: hypothetical protein

⊟Genome View

⊟Gene

⊟General

• type: CDS
• locus tag: SA0271 [new locus tag: SA_RS01590 ]
• symbol: SA0271
• product: hypothetical protein
• replicon: chromosome
• strand: +
• coordinates: 327073..327366
• length: 294
• essential: no DEG other strains

⊟Accession numbers

• Gene ID: 1123050 NCBI
• RefSeq: NP_373517 NCBI
• BioCyc: see SA_RS01590
• MicrobesOnline: 102543 MicrobesOnline

⊟Phenotype

Share your knowledge and add information here. [edit]

⊟DNA sequence

• 1
  61
  121
  181
  241
  
  ATGGCAATGATTAAGATGAGTCCAGAGGAAATCAGAGCAAAATCGCAATCTTACGGGCAA
  GGTTCAGACCAAATCCGTCAAATTTTATCTGATTTAACACGTGCACAAGGTGAAATTGCA
  GCGAACTGGGAAGGTCAAGCTTTCAGCCGTTTCGAAGAGCAATTCCAACAACTTAGTCCT
  AAAGTAGAAAAATTTGCACAATTATTAGAAGAAATTAAACAACAATTGAATAGCACTGCT
  GATGCCGTTCAAGAACAAGACCAACAACTTTCTAATAATTTCGGTTTGCAATAA
  60
  120
  180
  240
  294
  

⊟Protein

• 2VRZ
  PDB
• 2VS0
  PDB

Protein Data Bank: 2VRZ

Protein Data Bank: 2VS0

⊟General

• locus tag: SA0271 [new locus tag: SA_RS01590 ]
• symbol: SA0271
• description: hypothetical protein
• length: 97
• theoretical pI: 4.32285
• theoretical MW: 11036.2
• GRAVY: -0.765979

⊟Function

• TIGRFAM:
  WXG100 family type VII secretion target (TIGR03930; HMM-score: 80.2)
  and 4 more
  type VII secretion effector, TIGR04197 family (TIGR04197; HMM-score: 20.8)
  two transmembrane protein (TIGR04527; HMM-score: 18.8)
  putative zinc finger/helix-turn-helix protein, YgiT family (TIGR03830; HMM-score: 13.3)
  Genetic information processing Protein fate Protein folding and stabilization prefoldin, alpha subunit (TIGR00293; HMM-score: 10.3)
• TheSEED  :
  • 6 kDa early secretory antigenic target ESAT-6 (EsxA)
  Membrane Transport Protein secretion system, Type VII ESAT-6 proteins secretion system in Firmicutes  6 kDa early secretory antigenic target ESAT-6 (EsxA)
• PFAM:
  EsxAB (CL0352) WXG100; Proteins of 100 residues with WXG (PF06013; HMM-score: 78.1)
  and 28 more
  T7SS_ESX_EspC; Excreted virulence factor EspC, type VII ESX diderm (PF10824; HMM-score: 19.3)
  no clan defined Apolipoprotein; Apolipoprotein A1/A4/E domain (PF01442; HMM-score: 18.7)
  EzrA; Septation ring formation regulator, EzrA (PF06160; HMM-score: 18.3)
  KxDL; Uncharacterized conserved protein (PF10241; HMM-score: 18.3)
  DUF2130; Uncharacterized protein conserved in bacteria (DUF2130) (PF09903; HMM-score: 17.4)
  IFT57; Intra-flagellar transport protein 57 (PF10498; HMM-score: 16.8)
  Med2; Mediator complex subunit 2 (PF11214; HMM-score: 16.6)
  TSNAXIP1_N; Translin-associated factor X-interacting N-terminus (PF15739; HMM-score: 16.6)
  Filament; Intermediate filament protein (PF00038; HMM-score: 15.9)
  Tup_N; Tup N-terminal (PF08581; HMM-score: 15.8)
  Cast; RIM-binding protein of the cytomatrix active zone (PF10174; HMM-score: 15.7)
  ING; Inhibitor of growth proteins N-terminal histone-binding (PF12998; HMM-score: 15.1)
  Phage_30_3; Bacteriophage protein GP30.3 (PF08010; HMM-score: 15)
  DNA_repr_REX1B; DNA repair REX1-B (PF14966; HMM-score: 15)
  LXG; LXG domain of WXG superfamily (PF04740; HMM-score: 14.8)
  Mobilization_B; Mobilization protein B (PF17511; HMM-score: 14.8)
  PDDEXK (CL0236) RmuC; RmuC family (PF02646; HMM-score: 14.7)
  no clan defined CK2S; Casein Kinase 2 substrate (PF15011; HMM-score: 14.6)
  TRPM_tetra; Tetramerisation domain of TRPM (PF16519; HMM-score: 14.6)
  DUF5344; Family of unknown function (DUF5344) (PF17279; HMM-score: 14.6)
  Skp1; Skp1 family, dimerisation domain (PF01466; HMM-score: 13.6)
  Cytochrom_B562; Cytochrome b562 (PF07361; HMM-score: 12.6)
  MscS_porin; Mechanosensitive ion channel porin domain (PF12795; HMM-score: 11.9)
  OML_zippers (CL0590) LPP; Lipoprotein leucine-zipper (PF04728; HMM-score: 11.7)
  no clan defined UPF0449; Uncharacterised protein family UPF0449 (PF15136; HMM-score: 11.7)
  FapA; Flagellar Assembly Protein A (PF03961; HMM-score: 10.8)
  TMPIT; TMPIT-like protein (PF07851; HMM-score: 10.5)
  KNOX2; KNOX2 domain (PF03791; HMM-score: 10.3)

⊟Structure, modifications & cofactors

• domains:
• modifications:
• cofactors:
• effectors:

⊟Localization

• PSORTb: Extracellular
  • Cytoplasmic Score: 0
  • Cytoplasmic Membrane Score: 0
  • Cellwall Score: 0
  • Extracellular Score: 10
  • Internal Helices: 0
• LocateP: Intracellular
  • Prediction by SwissProt Classification: Cytoplasmic
  • Pathway Prediction: No pathway
  • Intracellular possibility: 1
  • Signal peptide possibility: -1
  • N-terminally Anchored Score: -1
  • Predicted Cleavage Site: No CleavageSite
• SignalP: no predicted signal peptide
  • SP(Sec/SPI): 0.005097
  • TAT(Tat/SPI): 0.000636
  • LIPO(Sec/SPII): 0.001053
• predicted transmembrane helices (TMHMM): 0

⊟Accession numbers

• GI: 15925984 NCBI
• RefSeq: NP_373517 NCBI
• UniProt: Q7A7S4 UniProt

⊟Protein sequence

• MAMIKMSPEEIRAKSQSYGQGSDQIRQILSDLTRAQGEIAANWEGQAFSRFEEQFQQLSPKVEKFAQLLEEIKQQLNSTADAVQEQDQQLSNNFGLQ

⊟Experimental data

• experimentally validated: data available for COL, NCTC8325
• protein localization: data available for COL
• quantitative data / protein copy number per cell: data available for COL
• interaction partners:

⊟Expression & Regulation

⊟Operon

• MicrobesOnline: no polycistronic organisation predicted

⊟Regulation

• regulator:

⊟Transcription pattern

• S.aureus Expression Data Browser: data available for NCTC8325

⊟Protein synthesis (provided by Aureolib)

• Aureolib: data available for COL

⊟Protein stability

• half-life: no data available

⊟Biological Material

⊟Mutants

⊟Expression vector

⊟lacZ fusion

⊟GFP fusion

⊟two-hybrid system

⊟FLAG-tag construct

⊟Antibody

⊟Other Information

You are kindly invited to share additional interesting facts.

⊟Literature

⊟References

⊟Relevant publications