From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0271 [new locus tag: SACOL_RS01375 ]
  • pan locus tag?: SAUPAN001175000
  • symbol: SACOL0271
  • pan gene symbol?: esxA
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL0271 [new locus tag: SACOL_RS01375 ]
  • symbol: SACOL0271
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 309844..310137
  • length: 294
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGGCAATGATTAAGATGAGTCCAGAGGAAATCAGAGCAAAATCGCAATCTTACGGGCAA
    GGTTCAGACCAAATCCGTCAAATTTTATCTGATTTAACACGTGCACAAGGTGAAATTGCA
    GCGAACTGGGAAGGTCAAGCTTTCAGCCGTTTCGAAGAGCAATTCCAACAACTTAGTCCT
    AAAGTAGAAAAATTTGCACAATTATTAGAAGAAATTAAACAACAATTGAATAGCACTGCT
    GATGCCGTTCAAGAACAAGACCAACAACTTTCTAATAATTTCGGTTTGCAATAA
    60
    120
    180
    240
    294

Protein[edit | edit source]

Protein Data Bank: 2VRZ
Protein Data Bank: 2VS0

General[edit | edit source]

  • locus tag: SACOL0271 [new locus tag: SACOL_RS01375 ]
  • symbol: SACOL0271
  • description: hypothetical protein
  • length: 97
  • theoretical pI: 4.32285
  • theoretical MW: 11036.2
  • GRAVY: -0.765979

Function[edit | edit source]

  • TIGRFAM:
    WXG100 family type VII secretion target (TIGR03930; HMM-score: 80.2)
    and 4 more
    type VII secretion effector, TIGR04197 family (TIGR04197; HMM-score: 20.8)
    two transmembrane protein (TIGR04527; HMM-score: 18.8)
    putative zinc finger/helix-turn-helix protein, YgiT family (TIGR03830; HMM-score: 13.3)
    Genetic information processing Protein fate Protein folding and stabilization prefoldin, alpha subunit (TIGR00293; HMM-score: 10.3)
  • TheSEED  :
    • 6 kDa early secretory antigenic target ESAT-6 (EsxA)
    Membrane Transport Protein secretion system, Type VII ESAT-6 proteins secretion system in Firmicutes  6 kDa early secretory antigenic target ESAT-6 (EsxA)
  • PFAM:
    EsxAB (CL0352) WXG100; Proteins of 100 residues with WXG (PF06013; HMM-score: 78.1)
    and 28 more
    T7SS_ESX_EspC; Excreted virulence factor EspC, type VII ESX diderm (PF10824; HMM-score: 19.3)
    no clan defined Apolipoprotein; Apolipoprotein A1/A4/E domain (PF01442; HMM-score: 18.7)
    EzrA; Septation ring formation regulator, EzrA (PF06160; HMM-score: 18.3)
    KxDL; Uncharacterized conserved protein (PF10241; HMM-score: 18.3)
    DUF2130; Uncharacterized protein conserved in bacteria (DUF2130) (PF09903; HMM-score: 17.4)
    IFT57; Intra-flagellar transport protein 57 (PF10498; HMM-score: 16.8)
    Med2; Mediator complex subunit 2 (PF11214; HMM-score: 16.6)
    TSNAXIP1_N; Translin-associated factor X-interacting N-terminus (PF15739; HMM-score: 16.6)
    Filament; Intermediate filament protein (PF00038; HMM-score: 15.9)
    Tup_N; Tup N-terminal (PF08581; HMM-score: 15.8)
    Cast; RIM-binding protein of the cytomatrix active zone (PF10174; HMM-score: 15.7)
    ING; Inhibitor of growth proteins N-terminal histone-binding (PF12998; HMM-score: 15.1)
    Phage_30_3; Bacteriophage protein GP30.3 (PF08010; HMM-score: 15)
    DNA_repr_REX1B; DNA repair REX1-B (PF14966; HMM-score: 15)
    LXG; LXG domain of WXG superfamily (PF04740; HMM-score: 14.8)
    Mobilization_B; Mobilization protein B (PF17511; HMM-score: 14.8)
    PDDEXK (CL0236) RmuC; RmuC family (PF02646; HMM-score: 14.7)
    no clan defined CK2S; Casein Kinase 2 substrate (PF15011; HMM-score: 14.6)
    TRPM_tetra; Tetramerisation domain of TRPM (PF16519; HMM-score: 14.6)
    DUF5344; Family of unknown function (DUF5344) (PF17279; HMM-score: 14.6)
    Skp1; Skp1 family, dimerisation domain (PF01466; HMM-score: 13.6)
    Cytochrom_B562; Cytochrome b562 (PF07361; HMM-score: 12.6)
    MscS_porin; Mechanosensitive ion channel porin domain (PF12795; HMM-score: 11.9)
    OML_zippers (CL0590) LPP; Lipoprotein leucine-zipper (PF04728; HMM-score: 11.7)
    no clan defined UPF0449; Uncharacterised protein family UPF0449 (PF15136; HMM-score: 11.7)
    FapA; Flagellar Assembly Protein A (PF03961; HMM-score: 10.8)
    TMPIT; TMPIT-like protein (PF07851; HMM-score: 10.5)
    KNOX2; KNOX2 domain (PF03791; HMM-score: 10.3)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 10
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005097
    • TAT(Tat/SPI): 0.000636
    • LIPO(Sec/SPII): 0.001053
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MAMIKMSPEEIRAKSQSYGQGSDQIRQILSDLTRAQGEIAANWEGQAFSRFEEQFQQLSPKVEKFAQLLEEIKQQLNSTADAVQEQDQQLSNNFGLQ

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1] [2] [3] [4] [5]
  • quantitative data / protein copy number per cell: 8704 [6]
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: 7.62 h [7]

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
    Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
    J Proteome Res: 2010, 9(3);1579-90
    [PubMed:20108986] [WorldCat.org] [DOI] (I p)
  3. Annette Dreisbach, Kristina Hempel, Girbe Buist, Michael Hecker, Dörte Becher, Jan Maarten van Dijl
    Profiling the surfacome of Staphylococcus aureus.
    Proteomics: 2010, 10(17);3082-96
    [PubMed:20662103] [WorldCat.org] [DOI] (I p)
  4. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  5. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  6. Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)
  7. Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]