Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL_RS01375 [old locus tag: SACOL0271 ]
- pan locus tag?: SAUPAN001175000
- symbol: SACOL_RS01375
- pan gene symbol?: esxA
- synonym:
- product: virulence factor EsxA
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL_RS01375 [old locus tag: SACOL0271 ]
- symbol: SACOL_RS01375
- product: virulence factor EsxA
- replicon: chromosome
- strand: +
- coordinates: 309844..310137
- length: 294
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGGCAATGATTAAGATGAGTCCAGAGGAAATCAGAGCAAAATCGCAATCTTACGGGCAA
GGTTCAGACCAAATCCGTCAAATTTTATCTGATTTAACACGTGCACAAGGTGAAATTGCA
GCGAACTGGGAAGGTCAAGCTTTCAGCCGTTTCGAAGAGCAATTCCAACAACTTAGTCCT
AAAGTAGAAAAATTTGCACAATTATTAGAAGAAATTAAACAACAATTGAATAGCACTGCT
GATGCCGTTCAAGAACAAGACCAACAACTTTCTAATAATTTCGGTTTGCAATAA60
120
180
240
294
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL_RS01375 [old locus tag: SACOL0271 ]
- symbol: SACOL_RS01375
- description: virulence factor EsxA
- length: 97
- theoretical pI: 4.32285
- theoretical MW: 11036.2
- GRAVY: -0.765979
⊟Function[edit | edit source]
- TIGRFAM: WXG100 family type VII secretion target (TIGR03930; HMM-score: 80.2)and 4 moretype VII secretion effector, TIGR04197 family (TIGR04197; HMM-score: 20.8)two transmembrane protein (TIGR04527; HMM-score: 18.8)putative zinc finger/helix-turn-helix protein, YgiT family (TIGR03830; HMM-score: 13.3)Protein fate Protein folding and stabilization prefoldin, alpha subunit (TIGR00293; HMM-score: 10.3)
- TheSEED: see SACOL0271
- PFAM: EsxAB (CL0352) WXG100; Proteins of 100 residues with WXG (PF06013; HMM-score: 81.5)and 32 moreEspA_EspE; EspA/EspE family (PF18879; HMM-score: 22.9)no clan defined KxDL; Uncharacterized conserved protein (PF10241; HMM-score: 20.1)EsxAB (CL0352) T7SS_ESX_EspC; Excreted virulence factor EspC, type VII ESX diderm (PF10824; HMM-score: 18.5)no clan defined FMP23; Found in mitochondrial proteome (PF17315; HMM-score: 18.2)ING; Inhibitor of growth proteins N-terminal histone-binding (PF12998; HMM-score: 17.5)Med2; Mediator complex subunit 2 (PF11214; HMM-score: 16.5)Apolipoprotein (CL0725) Apolipoprotein; Apolipoprotein A1/A4/E domain (PF01442; HMM-score: 16.4)no clan defined Cast; RIM-binding protein of the cytomatrix active zone (PF10174; HMM-score: 16.2)TSNAXIP1_N; Translin-associated factor X-interacting N-terminus (PF15739; HMM-score: 15.9)Filament; Intermediate filament protein (PF00038; HMM-score: 15.7)Tup_N; Tup N-terminal (PF08581; HMM-score: 15.5)Spectrin (CL0743) Spectrin; Spectrin repeat (PF00435; HMM-score: 15.4)TPR (CL0020) COG6_N; Conserved oligomeric complex COG6, N-terminal (PF06419; HMM-score: 15.4)no clan defined IFT57; Intra-flagellar transport protein 57 (PF10498; HMM-score: 15.3)EsxAB (CL0352) EspB_PPE; ESX-1 secretion-associated protein EspB, PPE domain (PF21856; HMM-score: 15.3)no clan defined DUF5917; Family of unknown function (DUF5917) (PF19314; HMM-score: 15.2)NADAR-like (CL0787) Phage_30_3; Bacteriophage protein GP30.3 (PF08010; HMM-score: 15)no clan defined Mobilization_B; Mobilization protein B (PF17511; HMM-score: 14.8)DNA_repr_REX1B; DNA repair REX1-B (PF14966; HMM-score: 14.6)EsxAB (CL0352) T7SS_signal; Putative T7SS secretion signal domain (PF21725; HMM-score: 14.6)Perilipin_sf (CL0718) Perilipin; Perilipin family (PF03036; HMM-score: 14.3)no clan defined TRPM_tetra; Tetramerisation domain of TRPM (PF16519; HMM-score: 14.1)EsxAB (CL0352) DUF5344; Family of unknown function (DUF5344) (PF17279; HMM-score: 14.1)F-box (CL0271) F-box_4; F-box (PF15966; HMM-score: 13.8)no clan defined MscS_porin; Mechanosensitive ion channel porin domain (PF12795; HMM-score: 13.3)Ariadne; Ariadne domain (PF19422; HMM-score: 13.2)Pec_lyase-like (CL0268) FapA; Flagellar Assembly Protein A beta solenoid domain (PF03961; HMM-score: 13.1)no clan defined Nup49_C; Nucleoporin Nup49 C-terminal helical region (PF21121; HMM-score: 12.7)Eplus_motif; E+ motif (PF20430; HMM-score: 12.5)UPF0449; Uncharacterised protein family UPF0449 (PF15136; HMM-score: 11.9)MG280; Uncharacterised protein MG280 (PF23067; HMM-score: 11.2)Fusion_gly (CL0595) CoV_S2; Coronavirus spike glycoprotein S2 (PF01601; HMM-score: 9.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Extracellular
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0
- Extracellular Score: 10
- Internal Helices: 0
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.0247
- Cytoplasmic Membrane Score: 0.0023
- Cell wall & surface Score: 0.0012
- Extracellular Score: 0.9718
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005097
- TAT(Tat/SPI): 0.000636
- LIPO(Sec/SPII): 0.001053
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MAMIKMSPEEIRAKSQSYGQGSDQIRQILSDLTRAQGEIAANWEGQAFSRFEEQFQQLSPKVEKFAQLLEEIKQQLNSTADAVQEQDQQLSNNFGLQ
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.