PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159JSNZLGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

⊟Summary

• organism: Staphylococcus aureus COL
• locus tag: SACOL_RS01375 [old locus tag: SACOL0271 ]
• pan locus tag^?: SAUPAN001175000
• symbol: SACOL_RS01375
• pan gene symbol^?: esxA
• synonym:
• product: virulence factor EsxA

⊟Genome View

⊟Gene

⊟General

• type: CDS
• locus tag: SACOL_RS01375 [old locus tag: SACOL0271 ]
• symbol: SACOL_RS01375
• product: virulence factor EsxA
• replicon: chromosome
• strand: +
• coordinates: 309844..310137
• length: 294
• essential: unknown other strains

⊟Accession numbers

• Location: NC_002951 (309844..310137) NCBI
• BioCyc: SACOL_RS01375 BioCyc
• MicrobesOnline: see SACOL0271

⊟Phenotype

Share your knowledge and add information here. [edit]

⊟DNA sequence

• 1
  61
  121
  181
  241
  
  ATGGCAATGATTAAGATGAGTCCAGAGGAAATCAGAGCAAAATCGCAATCTTACGGGCAA
  GGTTCAGACCAAATCCGTCAAATTTTATCTGATTTAACACGTGCACAAGGTGAAATTGCA
  GCGAACTGGGAAGGTCAAGCTTTCAGCCGTTTCGAAGAGCAATTCCAACAACTTAGTCCT
  AAAGTAGAAAAATTTGCACAATTATTAGAAGAAATTAAACAACAATTGAATAGCACTGCT
  GATGCCGTTCAAGAACAAGACCAACAACTTTCTAATAATTTCGGTTTGCAATAA
  60
  120
  180
  240
  294
  

⊟Protein

• 2VRZ
  PDB
• 2VS0
  PDB

Protein Data Bank: 2VRZ

Protein Data Bank: 2VS0

⊟General

• locus tag: SACOL_RS01375 [old locus tag: SACOL0271 ]
• symbol: SACOL_RS01375
• description: virulence factor EsxA
• length: 97
• theoretical pI: 4.32285
• theoretical MW: 11036.2
• GRAVY: -0.765979

⊟Function

• TIGRFAM:
  WXG100 family type VII secretion target (TIGR03930; HMM-score: 80.2)
  and 4 more
  type VII secretion effector, TIGR04197 family (TIGR04197; HMM-score: 20.8)
  two transmembrane protein (TIGR04527; HMM-score: 18.8)
  putative zinc finger/helix-turn-helix protein, YgiT family (TIGR03830; HMM-score: 13.3)
  Genetic information processing Protein fate Protein folding and stabilization prefoldin, alpha subunit (TIGR00293; HMM-score: 10.3)
• TheSEED: see SACOL0271
• PFAM:
  EsxAB (CL0352) WXG100; Proteins of 100 residues with WXG (PF06013; HMM-score: 81.5)
  and 32 more
  EspA_EspE; EspA/EspE family (PF18879; HMM-score: 22.9)
  no clan defined KxDL; Uncharacterized conserved protein (PF10241; HMM-score: 20.1)
  EsxAB (CL0352) T7SS_ESX_EspC; Excreted virulence factor EspC, type VII ESX diderm (PF10824; HMM-score: 18.5)
  no clan defined FMP23; Found in mitochondrial proteome (PF17315; HMM-score: 18.2)
  ING; Inhibitor of growth proteins N-terminal histone-binding (PF12998; HMM-score: 17.5)
  Med2; Mediator complex subunit 2 (PF11214; HMM-score: 16.5)
  Apolipoprotein (CL0725) Apolipoprotein; Apolipoprotein A1/A4/E domain (PF01442; HMM-score: 16.4)
  no clan defined Cast; RIM-binding protein of the cytomatrix active zone (PF10174; HMM-score: 16.2)
  TSNAXIP1_N; Translin-associated factor X-interacting N-terminus (PF15739; HMM-score: 15.9)
  Filament; Intermediate filament protein (PF00038; HMM-score: 15.7)
  Tup_N; Tup N-terminal (PF08581; HMM-score: 15.5)
  Spectrin (CL0743) Spectrin; Spectrin repeat (PF00435; HMM-score: 15.4)
  TPR (CL0020) COG6_N; Conserved oligomeric complex COG6, N-terminal (PF06419; HMM-score: 15.4)
  no clan defined IFT57; Intra-flagellar transport protein 57 (PF10498; HMM-score: 15.3)
  EsxAB (CL0352) EspB_PPE; ESX-1 secretion-associated protein EspB, PPE domain (PF21856; HMM-score: 15.3)
  no clan defined DUF5917; Family of unknown function (DUF5917) (PF19314; HMM-score: 15.2)
  NADAR-like (CL0787) Phage_30_3; Bacteriophage protein GP30.3 (PF08010; HMM-score: 15)
  no clan defined Mobilization_B; Mobilization protein B (PF17511; HMM-score: 14.8)
  DNA_repr_REX1B; DNA repair REX1-B (PF14966; HMM-score: 14.6)
  EsxAB (CL0352) T7SS_signal; Putative T7SS secretion signal domain (PF21725; HMM-score: 14.6)
  Perilipin_sf (CL0718) Perilipin; Perilipin family (PF03036; HMM-score: 14.3)
  no clan defined TRPM_tetra; Tetramerisation domain of TRPM (PF16519; HMM-score: 14.1)
  EsxAB (CL0352) DUF5344; Family of unknown function (DUF5344) (PF17279; HMM-score: 14.1)
  F-box (CL0271) F-box_4; F-box (PF15966; HMM-score: 13.8)
  no clan defined MscS_porin; Mechanosensitive ion channel porin domain (PF12795; HMM-score: 13.3)
  Ariadne; Ariadne domain (PF19422; HMM-score: 13.2)
  Pec_lyase-like (CL0268) FapA; Flagellar Assembly Protein A beta solenoid domain (PF03961; HMM-score: 13.1)
  no clan defined Nup49_C; Nucleoporin Nup49 C-terminal helical region (PF21121; HMM-score: 12.7)
  Eplus_motif; E+ motif (PF20430; HMM-score: 12.5)
  UPF0449; Uncharacterised protein family UPF0449 (PF15136; HMM-score: 11.9)
  MG280; Uncharacterised protein MG280 (PF23067; HMM-score: 11.2)
  Fusion_gly (CL0595) CoV_S2; Coronavirus spike glycoprotein S2 (PF01601; HMM-score: 9.8)

⊟Structure, modifications & cofactors

• domains:
• modifications:
• cofactors:
• effectors:

⊟Localization

• PSORTb: Extracellular
  • Cytoplasmic Score: 0
  • Cytoplasmic Membrane Score: 0
  • Cellwall Score: 0
  • Extracellular Score: 10
  • Internal Helices: 0
• DeepLocPro: Extracellular
  • Cytoplasmic Score: 0.0247
  • Cytoplasmic Membrane Score: 0.0023
  • Cell wall & surface Score: 0.0012
  • Extracellular Score: 0.9718
• LocateP:
• SignalP: no predicted signal peptide
  • SP(Sec/SPI): 0.005097
  • TAT(Tat/SPI): 0.000636
  • LIPO(Sec/SPII): 0.001053
• predicted transmembrane helices (TMHMM): 0

⊟Accession numbers

• GI: 447163570 NCBI
• RefSeq: WP_001240826 NCBI
• UniProt: see SACOL0271

⊟Protein sequence

• MAMIKMSPEEIRAKSQSYGQGSDQIRQILSDLTRAQGEIAANWEGQAFSRFEEQFQQLSPKVEKFAQLLEEIKQQLNSTADAVQEQDQQLSNNFGLQ

⊟Experimental data

• experimentally validated: see SACOL0271
• protein localization: see SACOL0271
• quantitative data / protein copy number per cell: see SACOL0271
• interaction partners:

⊟Expression & Regulation

⊟Operon

⊟Regulation

• regulator:

⊟Transcription pattern

• S.aureus Expression Data Browser: data available for NCTC8325

⊟Protein synthesis (provided by Aureolib)

• Aureolib: see SACOL0271

⊟Protein stability

• half-life: no data available

⊟Biological Material

⊟Mutants

⊟Expression vector

⊟lacZ fusion

⊟GFP fusion

⊟two-hybrid system

⊟FLAG-tag construct

⊟Antibody

⊟Other Information

You are kindly invited to share additional interesting facts.

⊟Literature

⊟References

⊟Relevant publications