From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS01375 [old locus tag: SACOL0271 ]
  • pan locus tag?: SAUPAN001175000
  • symbol: SACOL_RS01375
  • pan gene symbol?: esxA
  • synonym:
  • product: virulence factor EsxA

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL_RS01375 [old locus tag: SACOL0271 ]
  • symbol: SACOL_RS01375
  • product: virulence factor EsxA
  • replicon: chromosome
  • strand: +
  • coordinates: 309844..310137
  • length: 294
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_002951 (309844..310137) NCBI
  • BioCyc: SACOL_RS01375 BioCyc
  • MicrobesOnline: see SACOL0271

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGGCAATGATTAAGATGAGTCCAGAGGAAATCAGAGCAAAATCGCAATCTTACGGGCAA
    GGTTCAGACCAAATCCGTCAAATTTTATCTGATTTAACACGTGCACAAGGTGAAATTGCA
    GCGAACTGGGAAGGTCAAGCTTTCAGCCGTTTCGAAGAGCAATTCCAACAACTTAGTCCT
    AAAGTAGAAAAATTTGCACAATTATTAGAAGAAATTAAACAACAATTGAATAGCACTGCT
    GATGCCGTTCAAGAACAAGACCAACAACTTTCTAATAATTTCGGTTTGCAATAA
    60
    120
    180
    240
    294


Protein[edit | edit source]

Protein Data Bank: 2VRZ
Protein Data Bank: 2VS0

General[edit | edit source]

  • locus tag: SACOL_RS01375 [old locus tag: SACOL0271 ]
  • symbol: SACOL_RS01375
  • description: virulence factor EsxA
  • length: 97
  • theoretical pI: 4.32285
  • theoretical MW: 11036.2
  • GRAVY: -0.765979

Function[edit | edit source]

  • TIGRFAM:
    WXG100 family type VII secretion target (TIGR03930; HMM-score: 80.2)
    and 4 more
    type VII secretion effector, TIGR04197 family (TIGR04197; HMM-score: 20.8)
    two transmembrane protein (TIGR04527; HMM-score: 18.8)
    putative zinc finger/helix-turn-helix protein, YgiT family (TIGR03830; HMM-score: 13.3)
    Genetic information processing Protein fate Protein folding and stabilization prefoldin, alpha subunit (TIGR00293; HMM-score: 10.3)
  • TheSEED: see SACOL0271
  • PFAM:
    EsxAB (CL0352) WXG100; Proteins of 100 residues with WXG (PF06013; HMM-score: 81.5)
    and 32 more
    EspA_EspE; EspA/EspE family (PF18879; HMM-score: 22.9)
    no clan defined KxDL; Uncharacterized conserved protein (PF10241; HMM-score: 20.1)
    EsxAB (CL0352) T7SS_ESX_EspC; Excreted virulence factor EspC, type VII ESX diderm (PF10824; HMM-score: 18.5)
    no clan defined FMP23; Found in mitochondrial proteome (PF17315; HMM-score: 18.2)
    ING; Inhibitor of growth proteins N-terminal histone-binding (PF12998; HMM-score: 17.5)
    Med2; Mediator complex subunit 2 (PF11214; HMM-score: 16.5)
    Apolipoprotein (CL0725) Apolipoprotein; Apolipoprotein A1/A4/E domain (PF01442; HMM-score: 16.4)
    no clan defined Cast; RIM-binding protein of the cytomatrix active zone (PF10174; HMM-score: 16.2)
    TSNAXIP1_N; Translin-associated factor X-interacting N-terminus (PF15739; HMM-score: 15.9)
    Filament; Intermediate filament protein (PF00038; HMM-score: 15.7)
    Tup_N; Tup N-terminal (PF08581; HMM-score: 15.5)
    Spectrin (CL0743) Spectrin; Spectrin repeat (PF00435; HMM-score: 15.4)
    TPR (CL0020) COG6_N; Conserved oligomeric complex COG6, N-terminal (PF06419; HMM-score: 15.4)
    no clan defined IFT57; Intra-flagellar transport protein 57 (PF10498; HMM-score: 15.3)
    EsxAB (CL0352) EspB_PPE; ESX-1 secretion-associated protein EspB, PPE domain (PF21856; HMM-score: 15.3)
    no clan defined DUF5917; Family of unknown function (DUF5917) (PF19314; HMM-score: 15.2)
    NADAR-like (CL0787) Phage_30_3; Bacteriophage protein GP30.3 (PF08010; HMM-score: 15)
    no clan defined Mobilization_B; Mobilization protein B (PF17511; HMM-score: 14.8)
    DNA_repr_REX1B; DNA repair REX1-B (PF14966; HMM-score: 14.6)
    EsxAB (CL0352) T7SS_signal; Putative T7SS secretion signal domain (PF21725; HMM-score: 14.6)
    Perilipin_sf (CL0718) Perilipin; Perilipin family (PF03036; HMM-score: 14.3)
    no clan defined TRPM_tetra; Tetramerisation domain of TRPM (PF16519; HMM-score: 14.1)
    EsxAB (CL0352) DUF5344; Family of unknown function (DUF5344) (PF17279; HMM-score: 14.1)
    F-box (CL0271) F-box_4; F-box (PF15966; HMM-score: 13.8)
    no clan defined MscS_porin; Mechanosensitive ion channel porin domain (PF12795; HMM-score: 13.3)
    Ariadne; Ariadne domain (PF19422; HMM-score: 13.2)
    Pec_lyase-like (CL0268) FapA; Flagellar Assembly Protein A beta solenoid domain (PF03961; HMM-score: 13.1)
    no clan defined Nup49_C; Nucleoporin Nup49 C-terminal helical region (PF21121; HMM-score: 12.7)
    Eplus_motif; E+ motif (PF20430; HMM-score: 12.5)
    UPF0449; Uncharacterised protein family UPF0449 (PF15136; HMM-score: 11.9)
    MG280; Uncharacterised protein MG280 (PF23067; HMM-score: 11.2)
    Fusion_gly (CL0595) CoV_S2; Coronavirus spike glycoprotein S2 (PF01601; HMM-score: 9.8)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 10
    • Internal Helices: 0
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0.0247
    • Cytoplasmic Membrane Score: 0.0023
    • Cell wall & surface Score: 0.0012
    • Extracellular Score: 0.9718
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005097
    • TAT(Tat/SPI): 0.000636
    • LIPO(Sec/SPII): 0.001053
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MAMIKMSPEEIRAKSQSYGQGSDQIRQILSDLTRAQGEIAANWEGQAFSRFEEQFQQLSPKVEKFAQLLEEIKQQLNSTADAVQEQDQQLSNNFGLQ

Experimental data[edit | edit source]

  • experimentally validated: see SACOL0271
  • protein localization: see SACOL0271
  • quantitative data / protein copy number per cell: see SACOL0271
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]