From AureoWiki
Jump to navigation Jump to search

NCBI: 03-AUG-2016

Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00257
  • pan locus tag?: SAUPAN001175000
  • symbol: SAOUHSC_00257
  • pan gene symbol?: esxA
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_00257
  • symbol: SAOUHSC_00257
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 275931..276224
  • length: 294
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGGCAATGATTAAGATGAGTCCAGAGGAAATCAGAGCAAAATCGCAATCTTACGGGCAA
    GGTTCAGACCAAATCCGTCAAATTTTATCTGATTTAACACGTGCACAAGGTGAAATTGCA
    GCGAACTGGGAAGGTCAAGCTTTCAGCCGTTTCGAAGAGCAATTCCAACAACTTAGTCCT
    AAAGTAGAAAAATTTGCACAATTATTAGAAGAAATTAAACAACAATTGAATAGCACTGCT
    GATGCCGTTCAAGAACAAGACCAACAACTTTCTAATAATTTCGGTTTGCAATAA
    60
    120
    180
    240
    294

Protein[edit | edit source]

Protein Data Bank: 2VRZ
Protein Data Bank: 2VS0

General[edit | edit source]

  • locus tag: SAOUHSC_00257
  • symbol: SAOUHSC_00257
  • description: hypothetical protein
  • length: 97
  • theoretical pI: 4.32285
  • theoretical MW: 11036.2
  • GRAVY: -0.765979

Function[edit | edit source]

  • TIGRFAM:
    WXG100 family type VII secretion target (TIGR03930; HMM-score: 80.2)
    and 4 more
    type VII secretion effector, TIGR04197 family (TIGR04197; HMM-score: 20.8)
    two transmembrane protein (TIGR04527; HMM-score: 18.8)
    putative zinc finger/helix-turn-helix protein, YgiT family (TIGR03830; HMM-score: 13.3)
    Genetic information processing Protein fate Protein folding and stabilization prefoldin, alpha subunit (TIGR00293; HMM-score: 10.3)
  • TheSEED  :
    • 6 kDa early secretory antigenic target ESAT-6 (EsxA)
    Membrane Transport Protein secretion system, Type VII ESAT-6 proteins secretion system in Firmicutes  6 kDa early secretory antigenic target ESAT-6 (EsxA)
  • PFAM:
    EsxAB (CL0352) WXG100; Proteins of 100 residues with WXG (PF06013; HMM-score: 81.5)
    and 32 more
    EspA_EspE; EspA/EspE family (PF18879; HMM-score: 22.9)
    no clan defined KxDL; Uncharacterized conserved protein (PF10241; HMM-score: 20.1)
    EsxAB (CL0352) T7SS_ESX_EspC; Excreted virulence factor EspC, type VII ESX diderm (PF10824; HMM-score: 18.5)
    no clan defined FMP23; Found in mitochondrial proteome (PF17315; HMM-score: 18.2)
    ING; Inhibitor of growth proteins N-terminal histone-binding (PF12998; HMM-score: 17.5)
    Med2; Mediator complex subunit 2 (PF11214; HMM-score: 16.5)
    Apolipoprotein (CL0725) Apolipoprotein; Apolipoprotein A1/A4/E domain (PF01442; HMM-score: 16.4)
    no clan defined Cast; RIM-binding protein of the cytomatrix active zone (PF10174; HMM-score: 16.2)
    TSNAXIP1_N; Translin-associated factor X-interacting N-terminus (PF15739; HMM-score: 15.9)
    Filament; Intermediate filament protein (PF00038; HMM-score: 15.7)
    Tup_N; Tup N-terminal (PF08581; HMM-score: 15.5)
    Spectrin (CL0743) Spectrin; Spectrin repeat (PF00435; HMM-score: 15.4)
    TPR (CL0020) COG6_N; Conserved oligomeric complex COG6, N-terminal (PF06419; HMM-score: 15.4)
    no clan defined IFT57; Intra-flagellar transport protein 57 (PF10498; HMM-score: 15.3)
    EsxAB (CL0352) EspB_PPE; ESX-1 secretion-associated protein EspB, PPE domain (PF21856; HMM-score: 15.3)
    no clan defined DUF5917; Family of unknown function (DUF5917) (PF19314; HMM-score: 15.2)
    NADAR-like (CL0787) Phage_30_3; Bacteriophage protein GP30.3 (PF08010; HMM-score: 15)
    no clan defined Mobilization_B; Mobilization protein B (PF17511; HMM-score: 14.8)
    DNA_repr_REX1B; DNA repair REX1-B (PF14966; HMM-score: 14.6)
    EsxAB (CL0352) T7SS_signal; Putative T7SS secretion signal domain (PF21725; HMM-score: 14.6)
    Perilipin_sf (CL0718) Perilipin; Perilipin family (PF03036; HMM-score: 14.3)
    no clan defined TRPM_tetra; Tetramerisation domain of TRPM (PF16519; HMM-score: 14.1)
    EsxAB (CL0352) DUF5344; Family of unknown function (DUF5344) (PF17279; HMM-score: 14.1)
    F-box (CL0271) F-box_4; F-box (PF15966; HMM-score: 13.8)
    no clan defined MscS_porin; Mechanosensitive ion channel porin domain (PF12795; HMM-score: 13.3)
    Ariadne; Ariadne domain (PF19422; HMM-score: 13.2)
    Pec_lyase-like (CL0268) FapA; Flagellar Assembly Protein A beta solenoid domain (PF03961; HMM-score: 13.1)
    no clan defined Nup49_C; Nucleoporin Nup49 C-terminal helical region (PF21121; HMM-score: 12.7)
    Eplus_motif; E+ motif (PF20430; HMM-score: 12.5)
    UPF0449; Uncharacterised protein family UPF0449 (PF15136; HMM-score: 11.9)
    MG280; Uncharacterised protein MG280 (PF23067; HMM-score: 11.2)
    Fusion_gly (CL0595) CoV_S2; Coronavirus spike glycoprotein S2 (PF01601; HMM-score: 9.8)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 10
    • Internal Helices: 0
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0.0247
    • Cytoplasmic Membrane Score: 0.0023
    • Cell wall & surface Score: 0.0012
    • Extracellular Score: 0.9718
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005097
    • TAT(Tat/SPI): 0.000636
    • LIPO(Sec/SPII): 0.001053
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MAMIKMSPEEIRAKSQSYGQGSDQIRQILSDLTRAQGEIAANWEGQAFSRFEEQFQQLSPKVEKFAQLLEEIKQQLNSTADAVQEQDQQLSNNFGLQ

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas [1] [2]
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  2. Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  3. 3.0 3.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]