From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1856 [new locus tag: SA_RS10655 ]
  • pan locus tag?: SAUPAN005300000
  • symbol: SA1856
  • pan gene symbol?: tsaB
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA1856 [new locus tag: SA_RS10655 ]
  • symbol: SA1856
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2095977..2096666
  • length: 690
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGAACAAATTAAGGAGGCAATTATCCATGAATTCGCTGCTCATTGATACATCGAATCAA
    CCATTATCAGTAGCATTGATGCAAAACGATGAAGTTTTAGCTGAAATAACTACGGATTCT
    AAACAAAATCATTCAGTGCAATTAATGCCTGCGATTAGTCAGCTATTTGAGCAGAGCAAA
    ATAGCTAAACAGCAATTAGATGCGATTATTGTTGCTGAAGGTCCTGGTTCATATACTGGC
    TTACGTATCGGTGTTACTGTTGCTAAAACATTAGCGTATGCGTTAGATGTTAAATTATAT
    GGTGTTTCATCATTAAAGGCATTGGCAGCAACAATCGATCATACTGATAAATTATTGGTT
    CCTGTGTTTGATGCAAGACGACAAGCAGTTTATACAGGCATATTCCAGTGGCAAAATGGT
    CAATTAGTGACTATTTTAGAAGATCAATATATGTCGATAGAGGCATTGCGAGCTTTTTTA
    GAAGATTTAAACCAACCATTTATTTATATTGGGAAAGATACTATAAAATTACAAGATGAA
    TTACAAGGTGAAGTGATTGCGCAGCTACCAAATGCATCAGTCATGTATCAATTGATAGAT
    AAACCTACAGACGTACATACATTTACTCCTAAATACCATAAATTAGCTGAGGCGGAACGA
    AATTGGATCAACAGTCAAAAGAACAATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    690

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA1856 [new locus tag: SA_RS10655 ]
  • symbol: SA1856
  • description: hypothetical protein
  • length: 229
  • theoretical pI: 5.67604
  • theoretical MW: 25691.3
  • GRAVY: -0.165502

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis tRNA and rRNA base modification tRNA threonylcarbamoyl adenosine modification protein YeaZ (TIGR03725; HMM-score: 177.9)
    and 3 more
    Genetic information processing Protein synthesis tRNA and rRNA base modification tRNA threonylcarbamoyl adenosine modification protein TsaD (TIGR03723; HMM-score: 44)
    Genetic information processing Protein fate Degradation of proteins, peptides, and glycopeptides metallohydrolase, glycoprotease/Kae1 family (TIGR00329; HMM-score: 39.9)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair universal archaeal protein Kae1 (TIGR03722; HMM-score: 34.7)
  • TheSEED:  
    Cell Division and Cell Cycle Cell Division and Cell Cycle - no subcategory YgjD and YeaZ  TsaB protein, required for threonylcarbamoyladenosine (t(6)A) formation in tRNA
    and 7 more
    Cell Wall and Capsule Cell Wall and Capsule - no subcategory YjeE  TsaB protein, required for threonylcarbamoyladenosine (t(6)A) formation in tRNA
    Protein Metabolism Protein biosynthesis Ribosome biogenesis bacterial  TsaB protein, required for threonylcarbamoyladenosine (t(6)A) formation in tRNA
    RNA Metabolism RNA processing and modification t6A synthesis in bacteria  TsaB protein, required for threonylcarbamoyladenosine (t(6)A) formation in tRNA
    YrdC-YciO  TsaB protein, required for threonylcarbamoyladenosine (t(6)A) formation in tRNA
    YrdC-YciO-Sua5 and associated protein families  TsaB protein, required for threonylcarbamoyladenosine (t(6)A) formation in tRNA
    Bacterial RNA-metabolizing Zn-dependent hydrolases  TsaB protein, required for threonylcarbamoyladenosine (t(6)A) formation in tRNA
    Conserved gene cluster associated with Met-tRNA formyltransferase  TsaB protein, required for threonylcarbamoyladenosine (t(6)A) formation in tRNA
  • PFAM:
    Actin_ATPase (CL0108) Peptidase_M22; Glycoprotease family (PF00814; HMM-score: 108.5)
    and 1 more
    no clan defined DUF3126; Protein of unknown function (DUF3126) (PF11324; HMM-score: 12.3)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.022393
    • TAT(Tat/SPI): 0.002476
    • LIPO(Sec/SPII): 0.001267
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MNKLRRQLSMNSLLIDTSNQPLSVALMQNDEVLAEITTDSKQNHSVQLMPAISQLFEQSKIAKQQLDAIIVAEGPGSYTGLRIGVTVAKTLAYALDVKLYGVSSLKALAATIDHTDKLLVPVFDARRQAVYTGIFQWQNGQLVTILEDQYMSIEALRAFLEDLNQPFIYIGKDTIKLQDELQGEVIAQLPNASVMYQLIDKPTDVHTFTPKYHKLAEAERNWINSQKNN

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]