From AureoWiki
Jump to: navigation, search

NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1958 [new locus tag: NWMN_RS11295 ]
  • pan locus tag?: SAUPAN005300000
  • symbol: NWMN_1958
  • pan gene symbol?: tsaB
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_1958 [new locus tag: NWMN_RS11295 ]
  • symbol: NWMN_1958
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2167837..2168526
  • length: 690
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGAACAAATTAAGGAGGCAATTATCCATGAATTCGCTGCTCATTGATACATCGAATCAA
    CCATTATCAGTAGCATTGATGCAAAACGATGAAGTTTTAGCTGAAATAACTACGGATTCT
    AAACAAAATCATTCAGTGCAATTAATGCCTGCGATTAGTCAGCTATTTGAGCAGAGCAAA
    ATAGCTAAACAGCAATTAGATGCGATTATTGTTGCTGAAGGTCCTGGTTCATATACTGGC
    TTACGTATCGGTGTTACTGTTGCTAAAACATTAGCGTATGCGTTAGATGTTAAATTATAT
    GGTGTTTCATCATTAAAGGCATTGGCAGCAACAATCGATCATACTGATAAATTATTGGTT
    CCTGTGTTTGATGCAAGACGACAAGCAGTTTATACAGGCATGTTCCAGTGGCAAAATGGT
    CAATTAGTGACTATTTTAGAAGATCAATATATGTCGATAGAGGCATTGCGAGCTTTTTTA
    GAAGATTTAAACCAACCATTTATTTATATTGGGAAAGATACTGTAAAATTACAAGATGAA
    TTACAAGGTGAAGTGATTGCGCAGCTACCAAATGCATCAGTCATGTATCAATTGCTAGAT
    AAACCTTCAGACGTACATACATTTACTCCTAAATACCATAAATTAGCTGAGGCGGAACGA
    AATTGGATCAACAGTCAAAAGAACAATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    690

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_1958 [new locus tag: NWMN_RS11295 ]
  • symbol: NWMN_1958
  • description: hypothetical protein
  • length: 229
  • theoretical pI: 5.67604
  • theoretical MW: 25681.3
  • GRAVY: -0.181659

Function[edit source | edit]

  • TIGRFAM:
    Genetic information processingProtein synthesistRNA and rRNA base modificationtRNA threonylcarbamoyl adenosine modification protein YeaZ (TIGR03725; HMM-score: 178.9)
    and 3 more
    Genetic information processingProtein synthesistRNA and rRNA base modificationtRNA threonylcarbamoyl adenosine modification protein TsaD (TIGR03723; HMM-score: 44)
    Genetic information processingProtein fateDegradation of proteins, peptides, and glycopeptidesmetallohydrolase, glycoprotease/Kae1 family (TIGR00329; HMM-score: 39.9)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairuniversal archaeal protein Kae1 (TIGR03722; HMM-score: 34.7)
  • TheSEED:  
    Cell Division and Cell CycleCell Division and Cell Cycle - no subcategoryYgjD and YeaZ TsaB protein, required for threonylcarbamoyladenosine (t(6)A) formation in tRNA
    and 7 more
    Cell Wall and CapsuleCell Wall and Capsule - no subcategoryYjeE TsaB protein, required for threonylcarbamoyladenosine (t(6)A) formation in tRNA
    Protein MetabolismProtein biosynthesisRibosome biogenesis bacterial TsaB protein, required for threonylcarbamoyladenosine (t(6)A) formation in tRNA
    RNA MetabolismRNA processing and modificationt6A synthesis in bacteria TsaB protein, required for threonylcarbamoyladenosine (t(6)A) formation in tRNA
    YrdC-YciO TsaB protein, required for threonylcarbamoyladenosine (t(6)A) formation in tRNA
    YrdC-YciO-Sua5 and associated protein families TsaB protein, required for threonylcarbamoyladenosine (t(6)A) formation in tRNA
    Bacterial RNA-metabolizing Zn-dependent hydrolases TsaB protein, required for threonylcarbamoyladenosine (t(6)A) formation in tRNA
    Conserved gene cluster associated with Met-tRNA formyltransferase TsaB protein, required for threonylcarbamoyladenosine (t(6)A) formation in tRNA
  • PFAM:
    Actin_ATPase (CL0108) Peptidase_M22; Glycoprotease family (PF00814; HMM-score: 108.4)
    and 1 more
    no clan definedDUF3126; Protein of unknown function (DUF3126) (PF11324; HMM-score: 12.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.022393
    • TAT(Tat/SPI): 0.002476
    • LIPO(Sec/SPII): 0.001267
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MNKLRRQLSMNSLLIDTSNQPLSVALMQNDEVLAEITTDSKQNHSVQLMPAISQLFEQSKIAKQQLDAIIVAEGPGSYTGLRIGVTVAKTLAYALDVKLYGVSSLKALAATIDHTDKLLVPVFDARRQAVYTGMFQWQNGQLVTILEDQYMSIEALRAFLEDLNQPFIYIGKDTVKLQDELQGEVIAQLPNASVMYQLLDKPSDVHTFTPKYHKLAEAERNWINSQKNN

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]