From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2577 [new locus tag: SACOL_RS13500 ]
  • pan locus tag?: SAUPAN006226000
  • symbol: crtM
  • pan gene symbol?: crtM
  • synonym:
  • product: dehydrosqualene synthase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL2577 [new locus tag: SACOL_RS13500 ]
  • symbol: crtM
  • product: dehydrosqualene synthase
  • replicon: chromosome
  • strand: -
  • coordinates: 2640354..2641217
  • length: 864
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    ATGACAATGATGGATATGAATTTTAAATATTGTCATAAAATCATGAAGAAACATTCAAAA
    AGCTTTTCTTACGCTTTTGACTTGTTACCAGAAGATCAAAGAAAAGCGGTTTGGGCAATT
    TATGCTGTGTGTCGTAAAATTGATGACAGTATAGATGTTTATGGCGATATTCAATTTTTA
    AATCAAATAAAAGAAGATATACAATCTATTGAAAAATACCCATATGAACATCATCACTTT
    CAAAGTGATCGTAGAATCATGATGGCGCTTCAGCATGTTGCACAACATAAAAATATCGCC
    TTTCAATCTTTTTATAATCTCATTGATACTGTATATAAAGATCAACATTTTACAATGTTT
    GAAACGGACGCTGAATTATTCGGATATTGTTATGGTGTTGCTGGTACAGTAGGTGAAGTA
    TTGACGCCGATTTTAAGTGATCATGAAACACATCAGACATACGATGTCGCAAGAAGACTT
    GGTGAATCGTTGCAATTGATTAATATATTAAGAGATGTCGGTGAAGATTTTGACAATGAA
    CGGATATATTTTAGTAAGCAACGATTAAAGCAATATGAAGTTGATATTGCTGAAGTGTAC
    CAAAATGGTGTTAATAATCATTATATTGACTTATGGGAATATTATGCAGCTATCGCAGAA
    AAAGATTTTCAAGATGTTATGGATCAAATCAAAGTATTTAGTATTGAAGCACAACCAATC
    ATAGAATTAGCAGCACGTATATATATTGAAATACTGGACGAAGTGAGACAGGCTAACTAT
    ACATTACATGAACGTGTTTTTGTGGATAAGAGGAAAAAGGCAAAGTTGTTTCATGAAATA
    AATAGTAAATATCATAGAATATAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    864

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL2577 [new locus tag: SACOL_RS13500 ]
  • symbol: CrtM
  • description: dehydrosqualene synthase
  • length: 287
  • theoretical pI: 6.01098
  • theoretical MW: 34230.7
  • GRAVY: -0.449477

Function[edit | edit source]

  • reaction:
    EC 2.5.1.96?  ExPASy
    4,4'-diapophytoene synthase 2 (2E,6E)-farnesyl diphosphate = 15-cis-4,4'-diapophytoene + 2 diphosphate
  • TIGRFAM:
    squalene synthase HpnD (TIGR03465; EC 2.5.1.21; HMM-score: 144.9)
    and 2 more
    squalene synthase HpnC (TIGR03464; EC 2.4.1.21; HMM-score: 101.2)
    farnesyl-diphosphate farnesyltransferase (TIGR01559; EC 2.5.1.21; HMM-score: 51.1)
  • TheSEED:  
    Fatty Acids, Lipids, and Isoprenoids Isoprenoids Carotenoid biosynthesis  Dehydrosqualene synthase (EC 2.5.1.96)
    and 5 more
    Carotenoids  Dehydrosqualene synthase (EC 2.5.1.-)
    Dehydrosqualene synthase (EC 2.5.1.96)
    Polyprenyl Diphosphate Biosynthesis  Dehydrosqualene synthase (EC 2.5.1.-)
    Dehydrosqualene synthase (EC 2.5.1.96)
    CBSS-196620.1.peg.2477  Dehydrosqualene synthase (EC 2.5.1.96)
  • PFAM:
    Terp_synthase (CL0613) SQS_PSY; Squalene/phytoene synthase (PF00494; HMM-score: 195.5)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003464
    • TAT(Tat/SPI): 0.000176
    • LIPO(Sec/SPII): 0.000456
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDVYGDIQFLNQIKEDIQSIEKYPYEHHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMFETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFDNERIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFQDVMDQIKVFSIEAQPIIELAARIYIEILDEVRQANYTLHERVFVDKRKKAKLFHEINSKYHRI

Experimental data[edit | edit source]

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: RpoF* (activation) regulon
    RpoF(sigma factor)controlling a large regulon involved in stress/starvation response and adaptation [3] [4]   other strains

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  3. Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J Bacteriol: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)
  4. Jan Pané-Farré, Beate Jonas, Konrad Förstner, Susanne Engelmann, Michael Hecker
    The sigmaB regulon in Staphylococcus aureus and its regulation.
    Int J Med Microbiol: 2006, 296(4-5);237-58
    [PubMed:16644280] [WorldCat.org] [DOI] (P p)

Relevant publications[edit | edit source]

Fu-Yang Lin, Chia-I Liu, Yi-Liang Liu, Yonghui Zhang, Ke Wang, Wen-Yih Jeng, Tzu-Ping Ko, Rong Cao, Andrew H-J Wang, Eric Oldfield
Mechanism of action and inhibition of dehydrosqualene synthase.
Proc Natl Acad Sci U S A: 2010, 107(50);21337-42
[PubMed:21098670] [WorldCat.org] [DOI] (I p)