From AureoWiki
Jump to navigation Jump to search

NCBI: 03-AUG-2016

Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00342
  • pan locus tag?: SAUPAN001906000
  • symbol: SAOUHSC_00342
  • pan gene symbol?: parB
  • synonym:
  • product: ParB family chromosome partioning protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_00342
  • symbol: SAOUHSC_00342
  • product: ParB family chromosome partioning protein
  • replicon: chromosome
  • strand: +
  • coordinates: 356884..357729
  • length: 846
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    GTGAGTGAATTGTCAAAAAGTGAAGATCAACGTATTACTAAAACAAAAGATGAACAAATT
    AAGCAAATAGATATATCGGATATCAAACCGAATCCGTATCAGCCCCGAAAAACTTTCGAT
    GAAAATCATTTAAATGATTTGGCAGATTCAATTAAGCAATATGGAATTTTGCAACCAATT
    GTGCTTAGAAAAACAGTTCAAGGTTATTACATTGTAGTTGGTGAAAGAAGGTTTAGAGCT
    TCGAAAATTGCTGGTCTAAAATACGTATCAGCGATTATCAAAGATTTAACAGATGAAGAT
    ATGATGGAACTGGCGGTCATCGAAAATTTACAACGAGAAGACTTAAATGCGATTGAAGAA
    GCTGAAAGTTATCAACGTTTGATGACAGATTTGAAAATTACACAACAAGAAGTAGCGAAA
    CGATTGAGTAAGTCGCGCCCGTATATAGCGAATATGTTGAGGTTATTACATTTGCCGAAA
    AAGATTGCTGACATGGTAAAAGATGGGCGACTGACAAGTGCACATGGACGAACGTTATTG
    GCAATTAAAGATGAACAACAAATGCTTAGGTTAGCGAAACGGGTTGTTAAAGAAAAGTGG
    AGTGTCAGATATTTAGAAAACCATGTTAATGAATTAAAAAATGTTTCGTCAAAGTCGGAA
    ACAGACAAAGTAGATATAACTAAGCCTAAATTTATAAAGCAGCAAGAACGACAGTTGCGA
    GAACAGTATGGTACCAAAGTAGATATATCAATAAAAAAATCGGTTGGTAAAATCTCATTT
    GAGTTTGATTCACAAGAAGATTTTGTGAGAATAATTGAACAATTAAATCGTAGGTATGGT
    AAATAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    846

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAOUHSC_00342
  • symbol: SAOUHSC_00342
  • description: ParB family chromosome partioning protein
  • length: 281
  • theoretical pI: 10.0114
  • theoretical MW: 32855.6
  • GRAVY: -0.712456

Function[edit | edit source]

  • TIGRFAM:
    nucleoid occlusion protein (TIGR04285; HMM-score: 248.1)
    and 3 more
    ParB/RepB/Spo0J family partition protein (TIGR00180; HMM-score: 195.1)
    PRTRC system ParB family protein (TIGR03734; HMM-score: 118.7)
    Genetic information processing Mobile and extrachromosomal element functions Plasmid functions plasmid partitioning protein RepB (TIGR03454; HMM-score: 70.9)
  • TheSEED:  
    Cell Division and Cell Cycle Cell Division and Cell Cycle - no subcategory Bacterial Cytoskeleton  Chromosome (plasmid) partitioning protein ParB
    and 2 more
    Two cell division clusters relating to chromosome partitioning  Chromosome (plasmid) partitioning protein ParB
    Clustering-based subsystems Cell Division Cell Division Subsystem including YidCD  Chromosome (plasmid) partitioning protein ParB
  • PFAM:
    ParBc (CL0248) ParBc; ParB-like nuclease domain (PF02195; HMM-score: 94.5)
    and 12 more
    no clan defined Latarcin; Latarcin precursor (PF10279; HMM-score: 22.3)
    PDDEXK (CL0236) DUF1016; Protein of unknown function (DUF1016) (PF06250; HMM-score: 17.4)
    HTH (CL0123) KorB; KorB domain (PF08535; HMM-score: 17.1)
    HTH_3; Helix-turn-helix (PF01381; HMM-score: 16.7)
    MarR_2; MarR family (PF12802; HMM-score: 13.7)
    MerR_2; MerR HTH family regulatory protein (PF13591; HMM-score: 13.3)
    HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 13)
    no clan defined Statherin; Statherin (PF03875; HMM-score: 12.9)
    HTH (CL0123) TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 12.6)
    no clan defined CbeA_antitoxin; CbeA_antitoxin, type IV, cytoskeleton bundling-enhancing factor A (PF06154; HMM-score: 12.5)
    HTH (CL0123) HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 12.1)
    HTH_37; Helix-turn-helix domain (PF13744; HMM-score: 9.6)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.007656
    • TAT(Tat/SPI): 0.000789
    • LIPO(Sec/SPII): 0.000953
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MSELSKSEDQRITKTKDEQIKQIDISDIKPNPYQPRKTFDENHLNDLADSIKQYGILQPIVLRKTVQGYYIVVGERRFRASKIAGLKYVSAIIKDLTDEDMMELAVIENLQREDLNAIEEAESYQRLMTDLKITQQEVAKRLSKSRPYIANMLRLLHLPKKIADMVKDGRLTSAHGRTLLAIKDEQQMLRLAKRVVKEKWSVRYLENHVNELKNVSSKSETDKVDITKPKFIKQQERQLREQYGTKVDISIKKSVGKISFEFDSQEDFVRIIEQLNRRYGK

Experimental data[edit | edit source]

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

  • SAOUHSC_00342 no polycistronic organisation predicted

Regulation[edit | edit source]

  • regulator: CodY* (repression) regulon
    CodY(TF)important in Amino acid metabolism; RegPrecise  

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  2. Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  3. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]