Jump to navigation
Jump to search
NCBI: 03-AUG-2016
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus NCTC8325
- locus tag: SAOUHSC_02038
- pan locus tag?: SAUPAN001690000
- symbol: SAOUHSC_02038
- pan gene symbol?: —
- synonym:
- product: HK97 family phage protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAOUHSC_02038
- symbol: SAOUHSC_02038
- product: HK97 family phage protein
- replicon: chromosome
- strand: -
- coordinates: 1942978..1943325
- length: 348
- essential: no DEG
⊟Accession numbers[edit | edit source]
- Gene ID: 3920490 NCBI
- RefSeq: YP_500533 NCBI
- BioCyc: G1I0R-1930 BioCyc
- MicrobesOnline: 1290489 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGAATATAGATGGATTAGACGCACTGTTAAACCAATTTCACGATATGAAAACCAACATT
GATGATGATGTAGATGATATTTTACAGGAAAACGCCAAAGAATATGTAGTACGAGCTAAA
TTGAAAGCTAGAGAAGTAATGAATAAGGGTTATTGGACTGGTAATTTATCACGCAATATC
AGATATAAAAAAACTGGCGATTTGCAATACACTATCACATCGCACGCAGCTTATAGTGGT
TTCTTAGAATTTGGTACTCGATACATGGAGGCTGAACCTTTTATGTGGCCGGTATACGAA
GTGATTAGGAAATCAACTGTAGAAGAATTGAAAGCGTTGTTTGAATAG60
120
180
240
300
348
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAOUHSC_02038
- symbol: SAOUHSC_02038
- description: HK97 family phage protein
- length: 115
- theoretical pI: 4.9411
- theoretical MW: 13465.2
- GRAVY: -0.541739
⊟Function[edit | edit source]
- TIGRFAM: Mobile and extrachromosomal element functions Prophage functions phage protein, HK97 gp10 family (TIGR01725; HMM-score: 90.1)and 1 moreProtein fate Degradation of proteins, peptides, and glycopeptides ubiquitin-like protein Pup (TIGR03687; HMM-score: 15.1)
- TheSEED: Phage phi 11 orf37 protein homolog
- PFAM: Phage_tail (CL0348) HK97-gp10_like; Bacteriophage HK97-gp10, putative tail-component (PF04883; HMM-score: 39.7)and 2 moreHistone (CL0012) TFIID_20kDa; Transcription initiation factor TFIID subunit A (PF03847; HMM-score: 14.2)no clan defined Pup; Pup-like protein (PF05639; HMM-score: 12.5)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- protein partners:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.006787
- TAT(Tat/SPI): 0.000509
- LIPO(Sec/SPII): 0.000575
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNIDGLDALLNQFHDMKTNIDDDVDDILQENAKEYVVRAKLKAREVMNKGYWTGNLSRNIRYKKTGDLQYTITSHAAYSGFLEFGTRYMEAEPFMWPVYEVIRKSTVEELKALFE
⊟Experimental data[edit | edit source]
- experimentally validated: no data available
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SAOUHSC_02034 < SAOUHSC_02035 < SAOUHSC_02036 < SAOUHSC_02037 < SAOUHSC_02038 < SAOUHSC_02040 < SAOUHSC_02041 < SAOUHSC_02042
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑
Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
PLoS Genet: 2016, 12(4);e1005962
[PubMed:27035918] [WorldCat.org] [DOI] (I e)
⊟Relevant publications[edit | edit source]