Jump to navigation
Jump to search
NCBI: 03-AUG-2016
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus NCTC8325
- locus tag: SAOUHSC_02052
- pan locus tag?: SAUPAN001482000
- symbol: SAOUHSC_02052
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAOUHSC_02052
- symbol: SAOUHSC_02052
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1951119..1951265
- length: 147
- essential: no DEG
⊟Accession numbers[edit | edit source]
- Gene ID: 3920502 NCBI
- RefSeq: YP_500545 NCBI
- BioCyc: G1I0R-1942 BioCyc
- MicrobesOnline: 1290501 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGATGTGGTTAATCATAGCAATTATATTACTAGTCATCTTATTGTTTGGTGTGATGTTA
CAAGCGGAACAGTTAAAAGGTGATGTAAAAGTTAAAGAGCGAGAGATAGAGATATTAAGA
AGTAGATTGAGACACTTTGAAGATTAA60
120
147
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAOUHSC_02052
- symbol: SAOUHSC_02052
- description: hypothetical protein
- length: 48
- theoretical pI: 7.55167
- theoretical MW: 5720.98
- GRAVY: 0.635417
⊟Function[edit | edit source]
- TIGRFAM: Protein fate Protein folding and stabilization cytochrome c-type biogenesis protein CcmI (TIGR03142; HMM-score: 15.7)Energy metabolism Electron transport cytochrome c-type biogenesis protein CcmI (TIGR03142; HMM-score: 15.7)
- TheSEED: Phage protein ORF120
- PFAM: no clan defined Wzz; Chain length determinant protein (PF02706; HMM-score: 6.9)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- protein partners:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helix: 1
- LocateP: N-terminally anchored (with CS)
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: 0.5
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: VMLQAEQL
- SignalP: Signal peptide SP(Sec/SPI) length 22 aa
- SP(Sec/SPI): 0.550896
- TAT(Tat/SPI): 0.002648
- LIPO(Sec/SPII): 0.113674
- Cleavage Site: CS pos: 22-23. LQA-EQ. Pr: 0.4685
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MMWLIIAIILLVILLFGVMLQAEQLKGDVKVKEREIEILRSRLRHFED
⊟Experimental data[edit | edit source]
- experimentally validated: no data available
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- SAOUHSC_02052 no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑
Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
PLoS Genet: 2016, 12(4);e1005962
[PubMed:27035918] [WorldCat.org] [DOI] (I e)
⊟Relevant publications[edit | edit source]