From AureoWiki
Jump to navigation Jump to search

NCBI: 03-AUG-2016

Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_03010
  • pan locus tag?: SAUPAN006430000
  • symbol: hisH
  • pan gene symbol?: hisH
  • synonym:
  • product: imidazole glycerol phosphate synthase subunit HisH

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_03010
  • symbol: hisH
  • product: imidazole glycerol phosphate synthase subunit HisH
  • replicon: chromosome
  • strand: -
  • coordinates: 2784253..2784831
  • length: 579
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGATTGTCATCGTTGATTATGGATTAGGGAATATTAGTAATGTAAAACGCGCTATTGAA
    CATTTAGGGTATGAGGTGGTTGTCTCAAATACCTCAAAAATAATCGATCAAGCAGAAACA
    ATCATATTGCCCGGTGTCGGCCATTTTAAAGATGCGATGTCAGAGATAAAACGATTAAAT
    CTCAATGCAATATTGGCTAAGAATACTGATAAGAAGATGATTGGTATTTGTTTAGGCATG
    CAATTAATGTATGAGCATAGTGATGAAGGCGATGCATCTGGATTAGGGTTTATCCCAGGA
    AATATTTCGCGTATCCAAACAGAATACCCAGTGCCACACTTAGGCTGGAATAATTTAGTG
    AGTAAGCACCCTATGTTAAATCAAGATGTTTATTTCGTACATTCTTATCAAGCGCCGATG
    TCAGAAAATGTAATTGCATATGCGCAGTATGGGGCTGATATTCCGGCAATTGTTCAATTT
    AACAATTATATTGGTATTCAATTCCATCCTGAAAAAAGCGGTACATATGGGTTACAAATT
    TTGCGTCAGGCAATACAAGGGGGATTTATAAATGATTGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    579


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAOUHSC_03010
  • symbol: HisH
  • description: imidazole glycerol phosphate synthase subunit HisH
  • length: 192
  • theoretical pI: 6.13987
  • theoretical MW: 21279.2
  • GRAVY: -0.0348958

Function[edit | edit source]

  • reaction:
    EC 2.4.2.-?  ExPASy
    5-[(5-phospho-1-deoxyribulos-1-ylamino)methylideneamino]-1-(5-phosphoribosyl)imidazole-4-carboxamide + L-glutamine = imidazole-glycerol phosphate + 5-aminoimidazol-4-carboxamide ribonucleotide + L-glutamate + H2O?
  • TIGRFAM:
    Metabolism Amino acid biosynthesis Histidine family imidazole glycerol phosphate synthase, glutamine amidotransferase subunit (TIGR01855; EC 2.4.2.-; HMM-score: 239.6)
    and 7 more
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Purine ribonucleotide biosynthesis GMP synthase (glutamine-hydrolyzing), N-terminal domain (TIGR00888; EC 6.3.5.2; HMM-score: 29.3)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Pyridoxine pyridoxal 5'-phosphate synthase, glutaminase subunit Pdx2 (TIGR03800; EC 2.6.-.-; HMM-score: 22.3)
    glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase (TIGR00566; HMM-score: 18.8)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Pyrimidine ribonucleotide biosynthesis CTP synthase (TIGR00337; EC 6.3.4.2; HMM-score: 15.5)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin cobyric acid synthase CobQ (TIGR00313; EC 6.3.5.10; HMM-score: 15.2)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Pyrimidine ribonucleotide biosynthesis carbamoyl-phosphate synthase, small subunit (TIGR01368; EC 6.3.5.5; HMM-score: 14.4)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Purine ribonucleotide biosynthesis phosphoribosylformylglycinamidine synthase I (TIGR01737; EC 6.3.5.3; HMM-score: 13.5)
  • TheSEED  :
    • Imidazole glycerol-phosphate synthase amidotransferase subunit HisH (EC 4.3.2.10)
    Amino Acids and Derivatives Histidine Metabolism Histidine Biosynthesis  Imidazole glycerol phosphate synthase amidotransferase subunit (EC 2.4.2.-)
    and 1 more
    Amino Acids and Derivatives Histidine Metabolism Histidine Biosynthesis in plants  Imidazole glycerol phosphate synthase amidotransferase subunit (EC 2.4.2.-)
  • PFAM:
    Glutaminase_I (CL0014) GATase; Glutamine amidotransferase class-I (PF00117; HMM-score: 66)
    and 4 more
    SNO; SNO glutamine amidotransferase family (PF01174; HMM-score: 24)
    GATase_3; CobB/CobQ-like glutamine amidotransferase domain (PF07685; HMM-score: 15)
    no clan defined UPF0180; Uncharacterised protein family (UPF0180) (PF03698; HMM-score: 14.7)
    Glutaminase_I (CL0014) Peptidase_C26; Peptidase C26 (PF07722; HMM-score: 11.7)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9953
    • Cytoplasmic Membrane Score: 0.0004
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.0042
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002578
    • TAT(Tat/SPI): 0.000111
    • LIPO(Sec/SPII): 0.000353
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MIVIVDYGLGNISNVKRAIEHLGYEVVVSNTSKIIDQAETIILPGVGHFKDAMSEIKRLNLNAILAKNTDKKMIGICLGMQLMYEHSDEGDASGLGFIPGNISRIQTEYPVPHLGWNNLVSKHPMLNQDVYFVHSYQAPMSENVIAYAQYGADIPAIVQFNNYIGIQFHPEKSGTYGLQILRQAIQGGFIND

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas [1] [2]
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulators: CodY* (repression) regulon, HisR* (repression) regulon
    CodY*(TF)important in Amino acid metabolism; RegPrecise    transcription unit transferred from N315 data RegPrecise 
    HisR*(TF)important in Histidine biosynthesis; RegPrecise 

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  2. Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  3. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]