Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS13510 [old locus tag: SAUSA300_2437 ]
- pan locus tag?: SAUPAN006109000
- symbol: SAUSA300_RS13510
- pan gene symbol?: sarT
- synonym:
- product: transcriptional regulator
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS13510 [old locus tag: SAUSA300_2437 ]
- symbol: SAUSA300_RS13510
- product: transcriptional regulator
- replicon: chromosome
- strand: -
- coordinates: 2626556..2626876
- length: 321
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (2626556..2626876) NCBI
- BioCyc: SAUSA300_RS13510 BioCyc
- MicrobesOnline: see SAUSA300_2437
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGAAAAGAGTATTAACTACATATGAGCTGCGTAAATATTTAAAAAAATATTTTTGTCTT
ACATTAGATAATTATTTAGTATTAGCATATTTAGATGTATTTAAAAATGATGAAGGTAAA
TATTTTATGAGAGACATTATAAGTTATATCGGTATAGACCAATCTAGAATTGTTAAAAGC
GTAAAAGATTTATCAAAAAAGGGTTACTTGAATAAATGTAGAGACCCACATGATAGTAGA
AATGTAATCATTGTTGTTTCTGTAAAACAACACAATTATATTAAAAATCTTTTGAGTGAA
ATAAATATTAATGAAACATAA60
120
180
240
300
321
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS13510 [old locus tag: SAUSA300_2437 ]
- symbol: SAUSA300_RS13510
- description: transcriptional regulator
- length: 106
- theoretical pI: 9.79423
- theoretical MW: 12615.7
- GRAVY: -0.345283
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions staphylococcal accessory regulator family (TIGR01889; HMM-score: 114.9)and 1 moreRegulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 12.7)
- TheSEED: see SAUSA300_2437
- PFAM: HTH (CL0123) Staph_reg_Sar_Rot; Transcriptional regulator SarA/Rot (PF22381; HMM-score: 53.6)and 7 moreMarR_2; MarR family (PF12802; HMM-score: 32.5)HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 28.3)MarR; MarR family (PF01047; HMM-score: 19.4)TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 18.5)DnaD_N; DnaD N-terminal domain (PF21984; HMM-score: 16.4)no clan defined ELF; ELF protein (PF03317; HMM-score: 14.1)HTH (CL0123) B-block_TFIIIC; B-block binding subunit of TFIIIC (PF04182; HMM-score: 12.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.67
- Cytoplasmic Membrane Score: 0.01
- Cellwall Score: 0.15
- Extracellular Score: 0.17
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.7298
- Cytoplasmic Membrane Score: 0.0111
- Cell wall & surface Score: 0.0003
- Extracellular Score: 0.2588
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003444
- TAT(Tat/SPI): 0.000092
- LIPO(Sec/SPII): 0.000698
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: see SAUSA300_2437
- RefSeq: WP_001822204 NCBI
- UniProt: see SAUSA300_2437
⊟Protein sequence[edit | edit source]
- MKRVLTTYELRKYLKKYFCLTLDNYLVLAYLDVFKNDEGKYFMRDIISYIGIDQSRIVKSVKDLSKKGYLNKCRDPHDSRNVIIVVSVKQHNYIKNLLSEININET
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]