From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS08050 [old locus tag: SA1427 ]
  • pan locus tag?: SAUPAN004185000
  • symbol: SA_RS08050
  • pan gene symbol?: mtnN
  • synonym:
  • product: 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS08050 [old locus tag: SA1427 ]
  • symbol: SA_RS08050
  • product: 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase
  • replicon: chromosome
  • strand: -
  • coordinates: 1630803..1631489
  • length: 687
  • essential: no DEG other strains

Accession numbers[edit | edit source]

  • Location: NC_002745 (1630803..1631489) NCBI
  • BioCyc: SA_RS08050 BioCyc
  • MicrobesOnline: see SA1427

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGATTGGTATAATTGGTGCCATGGAAGAAGAAGTAACAATATTAAAAAATAAATTAACA
    CAATTAAGCGAAATTTCAGTTGCACATGTTAAATTTTATACTGGCATTTTAAAAGATAGA
    GAAGTAGTGATTACCCAAAGTGGCATTGGAAAAGTTAATGCTGCAATTTCTACGACATTA
    TTAATTAATAAGTTTAAACCGGACGTCATTATTAATACAGGTTCTGCTGGAGCTTTAGAT
    GAAAGTTTAAATGTAGGTGACGTTCTTATAAGTGATGATGTAAAATATCATGATGCGGAT
    GCAACAGCATTTGGTTATGAATATGGACAAATACCACAGATGCCGGTAGCATTTCAATCA
    AGTAAACCTTTAATAGAAAAAGTATCTCAAGTTGTACAACAACAACAATTAACAGCTAAA
    GTAGGCTTAATTGTAAGTGGTGATAGCTTTATCGGTAGTGTTGAACAACGCCAAAAAATT
    AAAAAAGCATTTCCAAATGCGATGGCGGTTGAAATGGAAGCAACTGCAATTGCACAAACA
    TGTTATCAATTTAATGTACCATTTGTTGTAGTTCGTGCAGTTTCAGACTTAGCAAATGGA
    GAAGCGGAAATGAGCTTCGAAGCATTTTTAGAAAAAGCAGCTGTATCATCAAGTCAAACT
    GTTGAAGCATTAGTGTCTCAATTATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    687


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA_RS08050 [old locus tag: SA1427 ]
  • symbol: SA_RS08050
  • description: 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase
  • length: 228
  • theoretical pI: 4.55905
  • theoretical MW: 24534
  • GRAVY: 0.183772

Function[edit | edit source]

  • reaction:
    EC 3.2.2.9?  ExPASy
    Adenosylhomocysteine nucleosidase S-adenosyl-L-homocysteine + H2O = S-(5-deoxy-D-ribos-5-yl)-L-homocysteine + adenine
    EC 3.2.2.16  ExPASy
    Methylthioadenosine nucleosidase S-methyl-5'-thioadenosine + H2O = S-methyl-5-thio-D-ribose + adenine?
  • TIGRFAM:
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Salvage of nucleosides and nucleotides MTA/SAH nucleosidase (TIGR01704; EC 3.2.2.16,3.2.2.9; HMM-score: 297.3)
    Metabolism Central intermediary metabolism Other MTA/SAH nucleosidase (TIGR01704; EC 3.2.2.16,3.2.2.9; HMM-score: 297.3)
    and 10 more
    futalosine hydrolase (TIGR03664; EC 3.2.2.26; HMM-score: 90.6)
    hopanoid-associated phosphorylase (TIGR03468; HMM-score: 78.2)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Salvage of nucleosides and nucleotides purine nucleoside phosphorylase (TIGR00107; EC 2.4.2.1; HMM-score: 61.6)
    putative 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase (TIGR01705; HMM-score: 52.4)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Salvage of nucleosides and nucleotides uridine phosphorylase (TIGR01718; EC 2.4.2.3; HMM-score: 33.8)
    AMP nucleosidase (TIGR01717; EC 3.2.2.4; HMM-score: 31.6)
    putative AMP nucleosidase (TIGR01721; HMM-score: 25.5)
    inosine/guanosine/xanthosine phosphorylase family (TIGR01697; EC 2.4.2.1; HMM-score: 18)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Salvage of nucleosides and nucleotides methylthioadenosine phosphorylase (TIGR01694; EC 2.4.2.28; HMM-score: 15.1)
    Metabolism Central intermediary metabolism Other methylthioadenosine phosphorylase (TIGR01694; EC 2.4.2.28; HMM-score: 15.1)
  • TheSEED: see SA1427
  • PFAM:
    PUP (CL0408) PNP_UDP_1; Phosphorylase superfamily (PF01048; HMM-score: 195.1)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9971
    • Cytoplasmic Membrane Score: 0.0006
    • Cell wall & surface Score: 0.0003
    • Extracellular Score: 0.0021
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002526
    • TAT(Tat/SPI): 0.000256
    • LIPO(Sec/SPII): 0.000288
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MIGIIGAMEEEVTILKNKLTQLSEISVAHVKFYTGILKDREVVITQSGIGKVNAAISTTLLINKFKPDVIINTGSAGALDESLNVGDVLISDDVKYHDADATAFGYEYGQIPQMPVAFQSSKPLIEKVSQVVQQQQLTAKVGLIVSGDSFIGSVEQRQKIKKAFPNAMAVEMEATAIAQTCYQFNVPFVVVRAVSDLANGEAEMSFEAFLEKAAVSSSQTVEALVSQL

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:
    SA_RS11130(deoA)pyrimidine-nucleoside phosphorylase  [1] (data from MRSA252)
    SA_RS00690immunoglobulin G-binding protein A  [1] (data from MRSA252)
    SA_RS01275formate acetyltransferase  [1] (data from MRSA252)
    SA_RS01365L-lactate dehydrogenase  [1] (data from MRSA252)
    SA_RS017105'-nucleotidase, lipoprotein e(P4) family  [1] (data from MRSA252)
    SA_RS02095alkyl hydroperoxide reductase subunit C  [1] (data from MRSA252)
    SA_RS02615pur operon repressor  [1] (data from MRSA252)
    SA_RS02710cysteine synthase  [1] (data from MRSA252)
    SA_RS0291050S ribosomal protein L1  [1] (data from MRSA252)
    SA_RS0291550S ribosomal protein L10  [1] (data from MRSA252)
    SA_RS0292050S ribosomal protein L7/L12  [1] (data from MRSA252)
    SA_RS0295030S ribosomal protein S7  [1] (data from MRSA252)
    SA_RS02955elongation factor G  [1] (data from MRSA252)
    SA_RS02960elongation factor Tu  [1] (data from MRSA252)
    SA_RS03250zinc-dependent alcohol dehydrogenase  [1] (data from MRSA252)
    SA_RS03575transcriptional regulator  [1] (data from MRSA252)
    SA_RS03910ribonucleotide-diphosphate reductase subunit alpha  [1] (data from MRSA252)
    SA_RS04020ribosomal subunit interface protein  [1] (data from MRSA252)
    SA_RS04140aldehyde dehydrogenase  [1] (data from MRSA252)
    SA_RS04160enolase  [1] (data from MRSA252)
    SA_RS04575NADH dehydrogenase  [1] (data from MRSA252)
    SA_RS04680glucose-6-phosphate isomerase  [1] (data from MRSA252)
    SA_RS04710hypothetical protein  [1] (data from MRSA252)
    SA_RS04785beta-ketoacyl-[acyl-carrier-protein] synthase II  [1] (data from MRSA252)
    SA_RS04895NAD(+) kinase  [1] (data from MRSA252)
    SA_RS05190bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase  [1] (data from MRSA252)
    SA_RS05350pyruvate dehydrogenase E1 component subunit alpha  [1] (data from MRSA252)
    SA_RS05355pyruvate dehydrogenase E1 component subunit beta  [1] (data from MRSA252)
    SA_RS05365dihydrolipoyl dehydrogenase  [1] (data from MRSA252)
    SA_RS05860cell division protein FtsZ  [1] (data from MRSA252)
    SA_RS0614050S ribosomal protein L19  [1] (data from MRSA252)
    SA_RS06165succinyl-CoA ligase subunit beta  [1] (data from MRSA252)
    SA_RS0622530S ribosomal protein S2  [1] (data from MRSA252)
    SA_RS06235elongation factor Ts  [1] (data from MRSA252)
    SA_RS06690transketolase  [1] (data from MRSA252)
    SA_RS07060dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex  [1] (data from MRSA252)
    SA_RS07205serine/threonine dehydratase  [1] (data from MRSA252)
    SA_RS07385DNA-binding protein HU  [1] (data from MRSA252)
    SA_RS0740030S ribosomal protein S1  [1] (data from MRSA252)
    SA_RS08135hypothetical protein  [1] (data from MRSA252)
    SA_RS0829550S ribosomal protein L21  [1] (data from MRSA252)
    SA_RS08505aldehyde dehydrogenase  [1] (data from MRSA252)
    SA_RS08545isocitrate dehydrogenase (NADP(+))  [1] (data from MRSA252)
    SA_RS08560pyruvate kinase  [1] (data from MRSA252)
    SA_RS08600universal stress protein  [1] (data from MRSA252)
    SA_RS08625universal stress protein UspA  [1] (data from MRSA252)
    SA_RS08630acetate kinase  [1] (data from MRSA252)
    SA_RS0867530S ribosomal protein S4  [1] (data from MRSA252)
    SA_RS08760formate--tetrahydrofolate ligase  [1] (data from MRSA252)
    SA_RS08865dipeptidase PepV  [1] (data from MRSA252)
    SA_RS08935proline dehydrogenase  [1] (data from MRSA252)
    SA_RS09810non-heme ferritin  [1] (data from MRSA252)
    SA_RS09850aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B  [1] (data from MRSA252)
    SA_RS10945UDP-N-acetylglucosamine 1-carboxyvinyltransferase  [1] (data from MRSA252)
    SA_RS11010uracil phosphoribosyltransferase  [1] (data from MRSA252)
    SA_RS11145purine-nucleoside phosphorylase  [1] (data from MRSA252)
    SA_RS11245glutamine--fructose-6-phosphate aminotransferase  [1] (data from MRSA252)
    SA_RS11430Asp23/Gls24 family envelope stress response protein  [1] (data from MRSA252)
    SA_RS1160030S ribosomal protein S9  [1] (data from MRSA252)
    SA_RS1160550S ribosomal protein L13  [1] (data from MRSA252)
    SA_RS11635DNA-directed RNA polymerase subunit alpha  [1] (data from MRSA252)
    SA_RS1164030S ribosomal protein S11  [1] (data from MRSA252)
    SA_RS1167050S ribosomal protein L15  [1] (data from MRSA252)
    SA_RS1168030S ribosomal protein S5  [1] (data from MRSA252)
    SA_RS1169050S ribosomal protein L6  [1] (data from MRSA252)
    SA_RS1170550S ribosomal protein L5  [1] (data from MRSA252)
    SA_RS1171550S ribosomal protein L14  [1] (data from MRSA252)
    SA_RS1172030S ribosomal protein S17  [1] (data from MRSA252)
    SA_RS1173530S ribosomal protein S3  [1] (data from MRSA252)
    SA_RS1174050S ribosomal protein L22  [1] (data from MRSA252)
    SA_RS1174530S ribosomal protein S19  [1] (data from MRSA252)
    SA_RS1175050S ribosomal protein L2  [1] (data from MRSA252)
    SA_RS1175550S ribosomal protein L23  [1] (data from MRSA252)
    SA_RS12400quinone oxidoreductase  [1] (data from MRSA252)
    SA_RS13730class I fructose-bisphosphate aldolase  [1] (data from MRSA252)
    SA_RS13735malate:quinone oxidoreductase  [1] (data from MRSA252)
    SA_RS13905carbamate kinase 2  [1] (data from MRSA252)
    SA_RS13920arginine deiminase  [1] (data from MRSA252)

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 1.38 1.39 1.40 1.41 1.42 1.43 1.44 1.45 1.46 1.47 1.48 1.49 1.50 1.51 1.52 1.53 1.54 1.55 1.56 1.57 1.58 1.59 1.60 1.61 1.62 1.63 1.64 1.65 1.66 1.67 1.68 1.69 1.70 1.71 1.72 1.73 1.74 1.75 1.76 1.77 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]