Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA_RS08265 [old locus tag: SA1467 ]
- pan locus tag?: SAUPAN004247000
- symbol: SA_RS08265
- pan gene symbol?: ruvB
- synonym:
- product: Holliday junction branch migration DNA helicase RuvB
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA_RS08265 [old locus tag: SA1467 ]
- symbol: SA_RS08265
- product: Holliday junction branch migration DNA helicase RuvB
- replicon: chromosome
- strand: -
- coordinates: 1676292..1677296
- length: 1005
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721
781
841
901
961ATGAATGAGCGTATGGTTGATCAATCAATGCATAGTGAAGAAACTGATTTCGAATTGTCG
CTTAGACCTACGAGATTACGACAATATATTGGTCAAAATTCAATAAAAAGTAATTTAGAA
GTATTTATTAAAGCGGCTAAACTTCGTCATGAACCATTAGATCATGTATTGCTTTTTGGC
CCCCCTGGATTAGGTAAGACAACATTATCTAATATCATTGCCAATGAAATGGAAGTTAAT
ATACGTACAGTATCAGGGCCTTCATTAGAAAGACCTGGTGATTTGGCTGCAATTTTATCA
GGACTTCAACCTGGAGATGTATTGTTTATTGATGAAATACACAGACTGAGTAGTGTTGTT
GAAGAAGTGTTATACCCTGCAATGGAAGATTTCTTTTTAGATATTATCATTGGTAAAGGC
GATGAGGCTAGAAGTATCCGTATCGACTTACCTCCATTCACTTTGGTAGGTGCAACAACG
CGAGCTGGCAGCTTAACAGGTCCACTAAGGGATCGATTTGGTGTGCACTTAAGATTAGAA
TATTATAATGAATCAGATTTAAAAGAAATCATTATTAGAACAGCTGAGGTTTTAGGCACA
GGTATTGATGAAGAAAGTGCCATTGAACTTGCTAAACGTTCTAGAGGGACTCCAAGAGTA
GCAAATCGACTATTGAAGCGGGTAAGAGACTTCCAGCAAGTGAATGAAGATGAACAAATA
TACATTGAAACAACGAAGCACGCATTAGGTTTACTTCAAGTTGATCAACACGGACTAGAT
TACATTGATCATAAAATGATGAACTGTATTATTAAGCAGTATAATGGTGGACCTGTTGGT
TTAGATACGATTGCCGTAACAATTGGTGAAGAACGTATTACAATTGAGGACGTTTATGAG
CCATTTCTTATTCAGAAAGGCTTTTTAGAACGTACGCCACGTGGCAGAAAAGCAACACCA
TTAGCTTATGAACATTTTGCAAAGTCGAATGAGGAGAGAGGATAA60
120
180
240
300
360
420
480
540
600
660
720
780
840
900
960
1005
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA_RS08265 [old locus tag: SA1467 ]
- symbol: SA_RS08265
- description: Holliday junction branch migration DNA helicase RuvB
- length: 334
- theoretical pI: 5.18816
- theoretical MW: 37645.7
- GRAVY: -0.313772
⊟Function[edit | edit source]
- reaction: EC 3.1.22.4? ExPASyCrossover junction endodeoxyribonuclease Endonucleolytic cleavage at a junction such as a reciprocal single-stranded crossover between two homologous DNA duplexes (Holliday junction)EC 3.6.4.12? ExPASyDNA helicase ATP + H2O = ADP + phosphate
- TIGRFAM: DNA metabolism DNA replication, recombination, and repair Holliday junction DNA helicase RuvB (TIGR00635; EC 3.6.4.12; HMM-score: 467)and 26 moreDNA metabolism DNA replication, recombination, and repair DNA polymerase III, subunit gamma and tau (TIGR02397; EC 2.7.7.7; HMM-score: 32.4)Cellular processes Sporulation and germination ATP-dependent protease, Lon family (TIGR02903; EC 3.4.21.-; HMM-score: 31.2)Protein fate Degradation of proteins, peptides, and glycopeptides ATP-dependent protease, Lon family (TIGR02903; EC 3.4.21.-; HMM-score: 31.2)Cellular processes Sporulation and germination ATP-dependent protease LonB (TIGR02902; EC 3.4.21.-; HMM-score: 29.3)Protein fate Degradation of proteins, peptides, and glycopeptides ATP-dependent protease LonB (TIGR02902; EC 3.4.21.-; HMM-score: 29.3)AAA family ATPase, CDC48 subfamily (TIGR01243; HMM-score: 26.7)26S proteasome subunit P45 family (TIGR01242; HMM-score: 20.6)DNA metabolism DNA replication, recombination, and repair orc1/cdc6 family replication initiation protein (TIGR02928; HMM-score: 19)Protein fate Protein and peptide secretion and trafficking type VII secretion AAA-ATPase EccA (TIGR03922; HMM-score: 18.7)DNA metabolism DNA replication, recombination, and repair DnaA regulatory inactivator Hda (TIGR03420; HMM-score: 18.4)DNA metabolism DNA replication, recombination, and repair chromosomal replication initiator protein DnaA (TIGR00362; HMM-score: 17.8)Cellular processes Cell division ATP-dependent metallopeptidase HflB (TIGR01241; EC 3.4.24.-; HMM-score: 17.2)Protein fate Degradation of proteins, peptides, and glycopeptides ATP-dependent metallopeptidase HflB (TIGR01241; EC 3.4.24.-; HMM-score: 17.2)Protein fate Degradation of proteins, peptides, and glycopeptides putative ATP-dependent protease (TIGR00764; HMM-score: 16.2)Purines, pyrimidines, nucleosides, and nucleotides Nucleotide and nucleoside interconversions adenylate kinase (TIGR01351; EC 2.7.4.-; HMM-score: 15.4)Protein fate Degradation of proteins, peptides, and glycopeptides ATP-dependent Clp protease ATP-binding subunit ClpA (TIGR02639; HMM-score: 14.7)Unknown function General Mg chelatase-like protein (TIGR00368; HMM-score: 14)Protein fate Degradation of proteins, peptides, and glycopeptides endopeptidase La (TIGR00763; EC 3.4.21.53; HMM-score: 13.4)Protein fate Degradation of proteins, peptides, and glycopeptides proteasome ATPase (TIGR03689; EC 3.6.4.8; HMM-score: 13.2)Cellular processes Sporulation and germination stage V sporulation protein K (TIGR02881; HMM-score: 13.1)type IV secretion/conjugal transfer ATPase, VirB4 family (TIGR00929; HMM-score: 12)Cellular processes Other gas vesicle protein GvpN (TIGR02640; HMM-score: 11.5)DNA metabolism DNA replication, recombination, and repair checkpoint protein rad24 (TIGR00602; HMM-score: 11.2)Protein fate Degradation of proteins, peptides, and glycopeptides ATP-dependent Clp protease, ATP-binding subunit ClpX (TIGR00382; HMM-score: 11.1)Protein fate Protein folding and stabilization ATP-dependent Clp protease, ATP-binding subunit ClpX (TIGR00382; HMM-score: 11.1)Biosynthesis of cofactors, prosthetic groups, and carriers Chlorophyll and bacteriochlorphyll magnesium chelatase ATPase subunit I (TIGR02030; EC 6.6.1.1; HMM-score: 11.1)
- TheSEED: see SA1467
- PFAM: P-loop_NTPase (CL0023) RuvB_N; Holliday junction DNA helicase ruvB N-terminus (PF05496; HMM-score: 379.7)and 24 moreHTH (CL0123) RuvB_C; Holliday junction DNA helicase ruvB C-terminus (PF05491; HMM-score: 115)P-loop_NTPase (CL0023) AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 67.3)AAA_5; AAA domain (dynein-related subfamily) (PF07728; HMM-score: 31.4)Mg_chelatase; Magnesium chelatase, subunit ChlI (PF01078; HMM-score: 22.3)AAA_22; AAA domain (PF13401; HMM-score: 19.6)DUF815; Protein of unknown function (DUF815) (PF05673; HMM-score: 19.1)AAA_3; ATPase family associated with various cellular activities (AAA) (PF07726; HMM-score: 18.7)AAA_16; AAA ATPase domain (PF13191; HMM-score: 17.4)RNA_helicase; RNA helicase (PF00910; HMM-score: 17.2)TsaE; Threonylcarbamoyl adenosine biosynthesis protein TsaE (PF02367; HMM-score: 16.9)AAA_18; AAA domain (PF13238; HMM-score: 16.6)Sigma54_activat; Sigma-54 interaction domain (PF00158; HMM-score: 16.4)TIP49; TIP49 C-terminus (PF06068; HMM-score: 16.4)AAA_14; AAA domain (PF13173; HMM-score: 16.4)RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 16.3)NTPase_1; NTPase (PF03266; HMM-score: 14.6)AAA_28; AAA domain (PF13521; HMM-score: 14.6)ABC_tran; ABC transporter (PF00005; HMM-score: 14.5)Sigma54_activ_2; Sigma-54 interaction domain (PF14532; HMM-score: 14.4)AAA_19; AAA domain (PF13245; HMM-score: 14.1)Bac_DnaA; Bacterial dnaA protein (PF00308; HMM-score: 12.6)NB-ARC; NB-ARC domain (PF00931; HMM-score: 12.2)T2SSE; Type II/IV secretion system protein (PF00437; HMM-score: 11.6)Rad17; Rad17 cell cycle checkpoint protein (PF03215; HMM-score: 11.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003423
- TAT(Tat/SPI): 0.000889
- LIPO(Sec/SPII): 0.000392
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNERMVDQSMHSEETDFELSLRPTRLRQYIGQNSIKSNLEVFIKAAKLRHEPLDHVLLFGPPGLGKTTLSNIIANEMEVNIRTVSGPSLERPGDLAAILSGLQPGDVLFIDEIHRLSSVVEEVLYPAMEDFFLDIIIGKGDEARSIRIDLPPFTLVGATTRAGSLTGPLRDRFGVHLRLEYYNESDLKEIIIRTAEVLGTGIDEESAIELAKRSRGTPRVANRLLKRVRDFQQVNEDEQIYIETTKHALGLLQVDQHGLDYIDHKMMNCIIKQYNGGPVGLDTIAVTIGEERITIEDVYEPFLIQKGFLERTPRGRKATPLAYEHFAKSNEERG
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
SA_RS11130 (deoA) pyrimidine-nucleoside phosphorylase [1] (data from MRSA252) SA_RS09855 (gatA) glutamyl-tRNA(Gln) amidotransferase subunit A [1] (data from MRSA252) SA_RS01275 formate acetyltransferase [1] (data from MRSA252) SA_RS02915 50S ribosomal protein L10 [1] (data from MRSA252) SA_RS02955 elongation factor G [1] (data from MRSA252) SA_RS02960 elongation factor Tu [1] (data from MRSA252) SA_RS03910 ribonucleotide-diphosphate reductase subunit alpha [1] (data from MRSA252) SA_RS04025 preprotein translocase subunit SecA [1] (data from MRSA252) SA_RS04140 aldehyde dehydrogenase [1] (data from MRSA252) SA_RS04160 enolase [1] (data from MRSA252) SA_RS04575 NADH dehydrogenase [1] (data from MRSA252) SA_RS04660 NAD-specific glutamate dehydrogenase [1] (data from MRSA252) SA_RS04710 hypothetical protein [1] (data from MRSA252) SA_RS05190 bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase [1] (data from MRSA252) SA_RS05355 pyruvate dehydrogenase E1 component subunit beta [1] (data from MRSA252) SA_RS05360 dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex [1] (data from MRSA252) SA_RS05365 dihydrolipoyl dehydrogenase [1] (data from MRSA252) SA_RS05860 cell division protein FtsZ [1] (data from MRSA252) SA_RS06170 succinyl-CoA ligase subunit alpha [1] (data from MRSA252) SA_RS06225 30S ribosomal protein S2 [1] (data from MRSA252) SA_RS06445 glycerol kinase [1] (data from MRSA252) SA_RS07065 2-oxoglutarate dehydrogenase E1 component [1] (data from MRSA252) SA_RS07205 serine/threonine dehydratase [1] (data from MRSA252) SA_RS07955 molecular chaperone DnaK [1] (data from MRSA252) SA_RS08460 50S ribosomal protein L20 [1] (data from MRSA252) SA_RS08480 threonine--tRNA ligase [1] (data from MRSA252) SA_RS08505 aldehyde dehydrogenase [1] (data from MRSA252) SA_RS08545 isocitrate dehydrogenase (NADP(+)) [1] (data from MRSA252) SA_RS08560 pyruvate kinase [1] (data from MRSA252) SA_RS08625 universal stress protein UspA [1] (data from MRSA252) SA_RS08675 30S ribosomal protein S4 [1] (data from MRSA252) SA_RS09850 aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [1] (data from MRSA252) SA_RS11010 uracil phosphoribosyltransferase [1] (data from MRSA252) SA_RS11070 UDP-N-acetylglucosamine 1-carboxyvinyltransferase [1] (data from MRSA252) SA_RS11245 glutamine--fructose-6-phosphate aminotransferase [1] (data from MRSA252) SA_RS11430 Asp23/Gls24 family envelope stress response protein [1] (data from MRSA252) SA_RS11600 30S ribosomal protein S9 [1] (data from MRSA252) SA_RS11680 30S ribosomal protein S5 [1] (data from MRSA252) SA_RS11710 50S ribosomal protein L24 [1] (data from MRSA252) SA_RS11735 30S ribosomal protein S3 [1] (data from MRSA252) SA_RS11740 50S ribosomal protein L22 [1] (data from MRSA252) SA_RS11760 50S ribosomal protein L4 [1] (data from MRSA252) SA_RS11770 30S ribosomal protein S10 [1] (data from MRSA252) SA_RS13340 pyruvate oxidase [1] (data from MRSA252) SA_RS13375 hydroxymethylglutaryl-CoA synthase [1] (data from MRSA252) SA_RS13705 L-lactate dehydrogenase [1] (data from MRSA252) SA_RS13735 malate:quinone oxidoreductase [1] (data from MRSA252) SA_RS13920 arginine deiminase [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 1.38 1.39 1.40 1.41 1.42 1.43 1.44 1.45 1.46 1.47 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)
⊟Relevant publications[edit | edit source]