From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0096 [new locus tag: NWMN_RS00540 ]
  • pan locus tag?: SAUPAN000975000
  • symbol: capB
  • pan gene symbol?: capB
  • synonym:
  • product: capsular polysaccharide synthesis enzyme CapB

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_0096 [new locus tag: NWMN_RS00540 ]
  • symbol: capB
  • product: capsular polysaccharide synthesis enzyme CapB
  • replicon: chromosome
  • strand: +
  • coordinates: 120144..120839
  • length: 696
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    TTGCTACTTATGTCAAAAAAGGAAAATACGACAACAACACTATTTGTATATGAAAAACCA
    AAATCAACAATTAGTGAAAAGTTTCGAGGTATACGTTCAAACATCATGTTTTCAAAAGCA
    AATGGTGAAGTAAAGCGCTTATTGGTTACTTCTGAAAAGCCTGGTGCAGGTAAAAGTACA
    GTTGTATCGAATGTAGCGATTACTTATGCACAAGCAGGCTATAAGACATTAGTTATTGAT
    GGCGATATGCGTAAGCCAACACAAAACTATATTTTTAATGAGCAAAATAATAATGGACTA
    TCAAGCTTAATCATTGGTCGAACGACTATGTCAGAAGCAATTACGTCGACAGAAATTGAA
    AATTTAGATTTGCTAACAGCTGGCCCTGTACCTCCAAATCCATCTGAGTTAATTGGGTCT
    GAAAGGTTCAAAGAATTAGTTGATCTGTTTAATAAACGTTACGACATTATTATTGTCGAT
    ACACCGCCAGTTAATACTGTGACTGATGCACAACTATATGCGCGTGCTATTAAAGATAGT
    CTGTTAGTAATTGATAGTGAAAAAAATGATAAAAATGAAGTTAAAAAAGCAAAAGCACTT
    ATGGAAAAAGCAGGCAGTAACATTCTAGGTGTCATTTTGAACAAGACAAAGGTCGATAAA
    TCTTCTAGTTATTATCACTATTATGGAGATGAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    696

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_0096 [new locus tag: NWMN_RS00540 ]
  • symbol: CapB
  • description: capsular polysaccharide synthesis enzyme CapB
  • length: 231
  • theoretical pI: 9.3191
  • theoretical MW: 25642.1
  • GRAVY: -0.374459

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidscapsular exopolysaccharide family (TIGR01007; HMM-score: 312.3)
    chain length determinant protein tyrosine kinase EpsG (TIGR03029; HMM-score: 149.5)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsexopolysaccharide transport protein family (TIGR01005; HMM-score: 123.8)
    exopolysaccharide/PEP-CTERM locus tyrosine autokinase (TIGR03018; EC 2.7.10.2; HMM-score: 121.2)
    cell division ATPase MinD (TIGR01969; HMM-score: 62)
    Cellular processesCellular processesCell divisionseptum site-determining protein MinD (TIGR01968; HMM-score: 42.3)
    Hypothetical proteinsConservedtransport-energizing ATPase, TRC40/GET3/ArsA family (TIGR00345; EC 3.6.1.-; HMM-score: 23.6)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidescellulose synthase operon protein YhjQ (TIGR03371; HMM-score: 20.7)
    MetabolismCentral intermediary metabolismNitrogen fixationnitrogenase iron protein (TIGR01287; EC 1.18.6.1; HMM-score: 20.5)
    Genetic information processingMobile and extrachromosomal element functionsPlasmid functionsplasmid partitioning protein RepA (TIGR03453; HMM-score: 20)
    helicase/secretion neighborhood CpaE-like protein (TIGR03815; HMM-score: 16.9)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesLAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 16.4)
    Signal transductionRegulatory functionsProtein interactionsLAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 16.4)
    MetabolismCentral intermediary metabolismSulfur metabolismadenylyl-sulfate kinase (TIGR00455; EC 2.7.1.25; HMM-score: 13.8)
    signal recognition particle protein SRP54 (TIGR01425; HMM-score: 13.8)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersChlorophyll and bacteriochlorphylllight-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein (TIGR01281; EC 1.3.7.7; HMM-score: 13.4)
    Genetic information processingMobile and extrachromosomal element functionsProphage functionsphage replicative helicase, DnaB family (TIGR03600; HMM-score: 12.9)
    arsenical pump-driving ATPase (TIGR04291; EC 3.6.1.-; HMM-score: 12.7)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingsignal recognition particle-docking protein FtsY (TIGR00064; HMM-score: 12.3)
    MetabolismEnergy metabolismPhotosynthesischlorophyllide reductase iron protein subunit X (TIGR02016; HMM-score: 11.9)
  • TheSEED:  
    Cell envelope-associated LytR-CpsA-Psr transcriptional attenuators Tyrosine-protein kinase EpsD (EC 2.7.10.2) / Capsular polysaccharide synthesis enzyme Cap5B 
    Exopolysaccharide Biosynthesis Tyrosine-protein kinase EpsD (EC 2.7.10.2) / Capsular polysaccharide synthesis enzyme Cap5B 
  • PFAM:
    P-loop_NTPase (CL0023) AAA_31; AAA domain (PF13614; HMM-score: 58.8)
    ParA; NUBPL iron-transfer P-loop NTPase (PF10609; HMM-score: 46.7)
    CbiA; CobQ/CobB/MinD/ParA nucleotide binding domain (PF01656; HMM-score: 42.2)
    MipZ; ATPase MipZ (PF09140; HMM-score: 37.9)
    ArsA_ATPase; Anion-transporting ATPase (PF02374; HMM-score: 21.7)
    AAA_26; AAA domain (PF13500; HMM-score: 20.6)
    Fer4_NifH; 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family (PF00142; HMM-score: 19.7)
    SRP54; SRP54-type protein, GTPase domain (PF00448; HMM-score: 19.3)
    ArgK; ArgK protein (PF03308; HMM-score: 18.8)
    CBP_BcsQ; Cellulose biosynthesis protein BcsQ (PF06564; HMM-score: 18.5)
    cobW; CobW/HypB/UreG, nucleotide-binding domain (PF02492; HMM-score: 16.5)
    Helicase_C; Helicase conserved C-terminal domain (PF00271; HMM-score: 15.3)
    no clan definedAFOR_N; Aldehyde ferredoxin oxidoreductase, N-terminal domain (PF02730; HMM-score: 13.6)
    P-loop_NTPase (CL0023) APS_kinase; Adenylylsulphate kinase (PF01583; HMM-score: 13)
    AAA_30; AAA domain (PF13604; HMM-score: 12.8)
    RRM (CL0221) GUCT; GUCT (NUC152) domain (PF08152; HMM-score: 12.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.01
    • Cytoplasmic Membrane Score: 9.99
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.184
    • Ymax_pos: 11
    • Cmax: 0.113
    • Cmax_pos: 41
    • Smax: 0.388
    • Smax_pos: 9
    • Smean: 0.333
    • D: 0.242
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MLLMSKKENTTTTLFVYEKPKSTISEKFRGIRSNIMFSKANGEVKRLLVTSEKPGAGKSTVVSNVAITYAQAGYKTLVIDGDMRKPTQNYIFNEQNNNGLSSLIIGRTTMSEAITSTEIENLDLLTAGPVPPNPSELIGSERFKELVDLFNKRYDIIIVDTPPVNTVTDAQLYARAIKDSLLVIDSEKNDKNEVKKAKALMEKAGSNILGVILNKTKVDKSSSYYHYYGDE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor: SigB [1] [2] other strains
    SigB (sigma factor) controls a large regulon involved in stress/starvation response and adaptation
  • regulator: CodY
    CodY (TF) important in Amino acid metabolism

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Bettina Schulthess, Dominik A Bloes, Patrice François, Myriam Girard, Jacques Schrenzel, Markus Bischoff, Brigitte Berger-Bächi
    The σB-dependent yabJ-spoVG operon is involved in the regulation of extracellular nuclease, lipase, and protease expression in Staphylococcus aureus.
    J. Bacteriol.: 2011, 193(18);4954-62
    [PubMed:21725011] [WorldCat.org] [DOI] (I p)
  2. Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J. Bacteriol.: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)

Relevant publications[edit source | edit]