From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1966 [new locus tag: NWMN_RS11345 ]
  • pan locus tag?: SAUPAN005310000
  • symbol: leuD
  • pan gene symbol?: leuD
  • synonym:
  • product: isopropylmalate isomerase small subunit

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_1966 [new locus tag: NWMN_RS11345 ]
  • symbol: leuD
  • product: isopropylmalate isomerase small subunit
  • replicon: chromosome
  • strand: +
  • coordinates: 2178325..2178897
  • length: 573
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGGCAGCAATCAAACCTATTACAACATATAAAGGTAAAATAGTCCCTCTCTTCAACGAC
    AATATCGATACAGACCAAATCATTCCTAAGGTACACTTAAAGCGTATTTCAAAAAGTGGC
    TTTGGTCCATTTGCTTTTGATGAATGGCGGTACTTACCTGATGGTTCAGATAATCCTGAT
    TTCAATCCTAACAAACCACAATATAAAGGGGCTTCTATTTTAATTACTGGAGATAATTTT
    GGATGTGGTTCAAGTCGTGAACATGCTGCTTGGGCTCTTAAGGACTATGGTTTTCATATT
    ATTATTGCAGGAAGTTTCAGTGACATATTTTATATGAATTGCACTAAAAATGCGATGTTG
    CCTATCGTTTTAGAAAAAAGTGCCCGTGAACATCTTGCACAATATGTTGAAATTGAGGTC
    GATTTACCAAATCAAACTGTGTCATCACCAGACAAGCGTTTCCATTTTGAAATTGATGAA
    ACTTGGAAGAATAAACTTGTAAATGGCTTAGATGACATTGCAATCACCCTACAATATGAA
    TCATTAATAGAAAAATATGAAAAATCACTTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    573

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_1966 [new locus tag: NWMN_RS11345 ]
  • symbol: LeuD
  • description: isopropylmalate isomerase small subunit
  • length: 190
  • theoretical pI: 5.63012
  • theoretical MW: 21578.4
  • GRAVY: -0.356842

Function[edit source | edit]

  • reaction:
    EC 4.2.1.33?  ExPASy
    3-isopropylmalate dehydratase(2R,3S)-3-isopropylmalate = (2S)-2-isopropylmalate
  • TIGRFAM:
    MetabolismAmino acid biosynthesisPyruvate family3-isopropylmalate dehydratase, small subunit (TIGR00171; EC 4.2.1.33; HMM-score: 223.5)
    3-isopropylmalate dehydratase, small subunit (TIGR02087; HMM-score: 83.1)
    MetabolismAmino acid biosynthesisPyruvate family3-isopropylmalate dehydratase, small subunit (TIGR02084; EC 4.2.1.33; HMM-score: 80)
    MetabolismEnergy metabolismTCA cycleputative aconitate hydratase (TIGR01342; EC 4.2.1.3; HMM-score: 48.1)
    MetabolismAmino acid biosynthesisAspartate familyhomoaconitase (TIGR00139; EC 4.2.1.36; HMM-score: 40.1)
    MetabolismEnergy metabolismTCA cycleaconitate hydratase, mitochondrial (TIGR01340; EC 4.2.1.3; HMM-score: 29)
    MetabolismEnergy metabolismTCA cycleaconitate hydratase 1 (TIGR01341; EC 4.2.1.3; HMM-score: 27.6)
    2-methylisocitrate dehydratase, Fe/S-dependent (TIGR02333; EC 4.2.1.99; HMM-score: 17.2)
  • TheSEED:  
    Amino Acids and DerivativesBranched-chain amino acidsBranched-Chain Amino Acid Biosynthesis 3-isopropylmalate dehydratase small subunit (EC 4.2.1.33) 
    Branched-chain amino acidsLeucine Biosynthesis 3-isopropylmalate dehydratase small subunit (EC 4.2.1.33) 
  • PFAM:
    Leu-IlvD (CL0364) Aconitase_C; Aconitase C-terminal domain (PF00694; HMM-score: 115.9)
    Aconitase_2_N; Aconitate hydratase 2 N-terminus (PF06434; HMM-score: 12.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.163
    • Ymax_pos: 11
    • Cmax: 0.11
    • Cmax_pos: 3
    • Smax: 0.435
    • Smax_pos: 1
    • Smean: 0.222
    • D: 0.186
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MAAIKPITTYKGKIVPLFNDNIDTDQIIPKVHLKRISKSGFGPFAFDEWRYLPDGSDNPDFNPNKPQYKGASILITGDNFGCGSSREHAAWALKDYGFHIIIAGSFSDIFYMNCTKNAMLPIVLEKSAREHLAQYVEIEVDLPNQTVSSPDKRFHFEIDETWKNKLVNGLDDIAITLQYESLIEKYEKSL

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: CodY
    CodY (TF) important in Amino acid metabolism  RegPrecise    transcription unit transferred from N315 data RegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]