From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0730 [new locus tag: SACOL_RS03750 ]
  • pan locus tag?: SAUPAN002553000
  • symbol: SACOL0730
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL0730 [new locus tag: SACOL_RS03750 ]
  • symbol: SACOL0730
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 754818..755462
  • length: 645
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    GTGAAAGTAAAGTATATAGATAAACGTCACTGGCGTCGCCTAATTGATAGGGAATACACA
    GAGGTAAAAGTTAATAATAATAGGTTTAAGGGTATTATAGGCTTAGTCACGATGAAAAAG
    GTTCGTGATCCTTTAGAGGTGACGGTAGTTGGACAAAATATCATTGTCGCAGATGACAAT
    TATAAATGGTTGCAAATACTACCTGAAAAGAAACGTTATAGTATAACTGTAATGTTTGAT
    AATAAAGGCAATCCATTAGAATATTATTTTGATATAAATATCAAAAATATAACGCAAAAA
    GGTAATGCGCGTACAGTAGATTTATGTTTAGATGTTTTAGCATTACCAAGTGGTGAATAT
    GAGTTGGTAGATGAAGATGATTTAATGTTTGCATTAGAAAGTGAGCAAATTACAAAAAAG
    CAATTTCATGAAGCATATATGATTGCACATCAAATTATGGCAGAGTTAGAAAATGATTTT
    AAAGGATTCCAAAAGAAAATCATGTACTGCTTTAATAAAATTAATGCAAAGGCTCAAAAA
    AATCATCAAAAGCCACAAAATAAAACTAATATTGAAAAAAGCAAACAAATAAAGCCTAAG
    CAATATAATCAAACTAAAAATCACCAACAACAAAAGAAAAACTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    645

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL0730 [new locus tag: SACOL_RS03750 ]
  • symbol: SACOL0730
  • description: hypothetical protein
  • length: 214
  • theoretical pI: 9.96721
  • theoretical MW: 25416.2
  • GRAVY: -0.827103

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    FIG01107967: hypothetical protein 
  • PFAM:
    no clan definedDUF402; Protein of unknown function (DUF402) (PF04167; HMM-score: 62.4)
    SAS-6_N; Centriolar protein SAS N-terminal (PF16531; HMM-score: 14.4)
    ABC_transp_aux; ABC-type uncharacterized transport system (PF09822; HMM-score: 13.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:
    SACOL1513(hup)DNA-binding protein HU  [1] (data from MRSA252)
    SACOL1727(infC)translation initiation factor IF-3  [1] (data from MRSA252)
    SACOL2239(rplC)50S ribosomal protein L3  [1] (data from MRSA252)
    SACOL2238(rplD)50S ribosomal protein L4  [1] (data from MRSA252)
    SACOL2224(rplF)50S ribosomal protein L6  [1] (data from MRSA252)
    SACOL2232(rplP)50S ribosomal protein L16  [1] (data from MRSA252)
    SACOL1257(rplS)50S ribosomal protein L19  [1] (data from MRSA252)
    SACOL2234(rplV)50S ribosomal protein L22  [1] (data from MRSA252)
    SACOL2237(rplW)50S ribosomal protein L23  [1] (data from MRSA252)
    SACOL1769(rpsD)30S ribosomal protein S4  [1] (data from MRSA252)
    SACOL2206(rpsI)30S ribosomal protein S9  [1] (data from MRSA252)
    SACOL2230(rpsQ)30S ribosomal protein S17  [1] (data from MRSA252)
    SACOL03035'-nucleotidase  [1] (data from MRSA252)
    SACOL1753universal stress protein  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.112
    • Ymax_pos: 51
    • Cmax: 0.11
    • Cmax_pos: 58
    • Smax: 0.17
    • Smax_pos: 1
    • Smean: 0.097
    • D: 0.106
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKVKYIDKRHWRRLIDREYTEVKVNNNRFKGIIGLVTMKKVRDPLEVTVVGQNIIVADDNYKWLQILPEKKRYSITVMFDNKGNPLEYYFDINIKNITQKGNARTVDLCLDVLALPSGEYELVDEDDLMFALESEQITKKQFHEAYMIAHQIMAELENDFKGFQKKIMYCFNKINAKAQKNHQKPQNKTNIEKSKQIKPKQYNQTKNHQQQKKN

Experimental data[edit source | edit]

  • experimental localization: Cytoplasmic [2] [3]
    quantitative data / protein copy number per cell: 45 [4]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: CodY
    CodY (TF) important in Amino acid metabolism  RegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13

Relevant publications[edit source | edit]