From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01162
  • pan locus tag?: SAUPAN003476000
  • symbol: lspA
  • pan gene symbol?: lspA
  • synonym:
  • product: lipoprotein signal peptidase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_01162
  • symbol: lspA
  • product: lipoprotein signal peptidase
  • replicon: chromosome
  • strand: +
  • coordinates: 1111794..1112285
  • length: 492
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGCACAAAAAATATTTTATTGGCACTTCCATTTTAATAGCAGTATTTGTCGTTATATTT
    GACCAAGTTACTAAATATATTATAGCTACTACAATGAAAATTGGAGATTCATTTGAAGTG
    ATACCGCACTTTTTAAACATAACATCACATCGAAATAATGGTGCTGCATGGGGAATATTG
    AGTGGAAAAATGACATTTTTCTTTATTATTACCATTATTATATTAATAGCCTTAGTATAT
    TTCTTTATTAAAGATGCTCAATATAATTTGTTTATGCAAGTTGCTATTAGTTTACTTTTT
    GCAGGTGCACTTGGAAACTTTATTGATAGAATTTTAACAGGAGAAGTTGTTGACTTTATT
    GATACAAATATTTTTGGTTATGATTTTCCAATATTTAATATCGCAGATTCAAGTTTAACA
    ATTGGTGTAATATTAATTATTATTGCCTTATTAAAGGATACTTCCAATAAAAAGGAGAAG
    GAGGTTAAGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    492

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_01162
  • symbol: LspA
  • description: lipoprotein signal peptidase
  • length: 163
  • theoretical pI: 7.75901
  • theoretical MW: 18341.6
  • GRAVY: 0.80184

Function[edit source | edit]

  • reaction:
    EC 3.4.23.36?  ExPASy
    Signal peptidase IIRelease of signal peptides from bacterial membrane prolipoproteins. Hydrolyzes -Xaa-Yaa-Zaa-|-(S,diacylglyceryl)Cys-, in which Xaa is hydrophobic (preferably Leu), and Yaa (Ala or Ser) and Zaa (Gly or Ala) have small, neutral side chains
  • TIGRFAM:
    Genetic information processingProtein fateProtein and peptide secretion and traffickingsignal peptidase II (TIGR00077; EC 3.4.23.36; HMM-score: 135.8)
  • TheSEED:  
    Protein MetabolismProtein processing and modificationLipoprotein Biosynthesis Lipoprotein signal peptidase (EC 3.4.23.36) 
    Protein processing and modificationSignal peptidase Lipoprotein signal peptidase (EC 3.4.23.36) 
    Regulation and Cell signalingRegulation and Cell signaling - no subcategorySex pheromones in Enterococcus faecalis and other Firmicutes Lipoprotein signal peptidase (EC 3.4.23.36) 
  • PFAM:
    no clan definedPeptidase_A8; Signal peptidase (SPase) II (PF01252; HMM-score: 123.9)
    DUF2530; Protein of unknown function (DUF2530) (PF10745; HMM-score: 10.1)
    DUF4418; Domain of unknown function (DUF4418) (PF14387; HMM-score: 9.6)
    DUF3671; Protein of unknown function (PF12420; HMM-score: 7.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 4
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.192
    • Ymax_pos: 11
    • Cmax: 0.178
    • Cmax_pos: 30
    • Smax: 0.526
    • Smax_pos: 1
    • Smean: 0.332
    • D: 0.247
  • predicted transmembrane helices (TMHMM): 4

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MHKKYFIGTSILIAVFVVIFDQVTKYIIATTMKIGDSFEVIPHFLNITSHRNNGAAWGILSGKMTFFFIITIIILIALVYFFIKDAQYNLFMQVAISLLFAGALGNFIDRILTGEVVDFIDTNIFGYDFPIFNIADSSLTIGVILIIIALLKDTSNKKEKEVK

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-3661
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  2. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet.: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]