From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001858000
  • symbol?: sirTM
  • description?: Sir2 family NAD-dependent protein deacetylase-like protein

      descriptions from strain specific annotations:

    • Sir2 family NAD-dependent protein deacetylase-like protein
    • NAD-dependent protein deacetylase, SIR2 family
    • NAD-dependent protein deacetylase SIR2 family-like protein
    • NAD-dependent protein deacetylase of SIR2family
    • SIR2 family protein
    • Sir2 silent information regulator family NAD-dependent deacetylase
  • strand?: +
  • coordinates?: 2355841..2356801
  • synteny block?: BlockID0012330
  • occurrence?: in 94% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0325
    08BA02176:
    11819-97:
    MS7_0316
    71193:
    ST398NM01_0406
    ECT-R 2:
    ECTR2_286
    ED133:
    SAOV_0352
    ED98:
    SAAV_0294
    HO 5096 0412:
    SAEMRSA15_02820
    JH1:
    SaurJH1_0385
    JH9:
    SaurJH9_0375
    JKD6008:
    SAA6008_00303
    JKD6159:
    SAA6159_00302
    LGA251:
    SARLGA251_02880
    M013:
    M013TW_0307
    MRSA252:
    SAR0323
    MSHR1132:
    SAMSHR1132_03000
    MSSA476:
    SAS0303
    Mu3:
    SAHV_0323
    Mu50:
    SAV0326
    MW2:
    MW0303
    RF122:
    SAB0276
    ST398:
    T0131:
    SAT0131_00331 (valS)
    TCH60:
    HMPREF0772_10169
    TW20:
    SATW20_03940
    USA300_TCH1516:
    USA300HOU_0347
    VC40:
    SAVC_01380

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -MQSSKWNAMSLLMDDKTKQAEVLRTAIDEADAIVIGIGAGMSASDGFTYVGERFTENFP
    N315            MMQSSKWNAMSLLMDEKTKQAEVLRTAIDEADAIVIGIGAGMSASDGFTYVGERFTENFP
    NCTC8325        -MQSSKWNAMSLLMDDKTKQAEVLRTAIDEADAIVIGIGAGMSASDGFTYVGERFTENFP
    Newman          -MQSSKWNAMSLLMDDKTKQAEVLRTAIDEADAIVIGIGAGMSASDGFTYVGERFTENFP
    USA300_FPR3757  -MQSSKWNAMSLLMDDKTKQAEVLRTAIDEADAIVIGIGAGMSASDGFTYVGERFTENFP
                     **************:********************************************

    COL             DFIEKYRFFDMLQASLHPYGSWQEYWAFESRFITLNYLDQPVGQSYLALKSLVEGKQYHI
    N315            DFIEKYRFFDMLQASLHPYGSWQEYWAFESRFITLNYLDQPVGQSYLALKSLVEGKQYHI
    NCTC8325        DFIEKYRFFDMLQASLHPYGSWQEYWAFESRFITLNYLDQPVGQSYLALKSLVEGKQYHI
    Newman          DFIEKYRFFDMLQASLHPYGSWQEYWAFESRFITLNYLDQPVGQSYLALKSLVEGKQYHI
    USA300_FPR3757  DFIEKYRFFDMLQASLHPYGSWQEYWAFESRFITLNYLDQPVGQSYLALKSLVEGKQYHI
                    ************************************************************

    COL             ITTNADNAFDVADYDMTHVFHIQGEYILQQCSQHCHAQTYRNDDLIRKMVVAQQDMLIPW
    N315            ITTNADNAFDAAEYDMTHVFHIQGEYILQQCSQHCHAQTYRNDDLIRKMVVAQQDMLIPW
    NCTC8325        ITTNADNAFDVADYDMTHVFHIQGEYILQQCSQHCHAQTYRNDDLIRKMVVAQQDMLIPW
    Newman          ITTNADNAFDVADYDMTHVFHIQGEYILQQCSQHCHAQTYRNDDLIRKMVVAQQDMLIPW
    USA300_FPR3757  ITTNADNAFDVADYDMTHVFHIQGEYILQQCSQHCHAQTYRNDDLIRKMVVAQQDMLIPW
                    **********.*:***********************************************

    COL             EMIPRCPKCDAPMEVNKRKAEVGMVEDAEFHAQLHRYNAFLEQHQDDKVLYLEIGIGYTT
    N315            EMIPRCPKCDAPMEVNKRKAEVGMVEDAEFHAQLQRYNAFLEQHQDDKVLYLEIGIGYTT
    NCTC8325        EMIPRCPKCDAPMEVNKRKAEVGMVEDAEFHAQLHRYNAFLEQHQDDKVLYLEIGIGYTT
    Newman          EMIPRCPKCDAPMEVNKRKAEVGMVEDAEFHAQLHRYNAFLEQHQDDKVLYLEIGIGYTT
    USA300_FPR3757  EMIPRCPKCDAPMEVNKRKAEVGMVEDAEFHAQLHRYNAFLEQHQDDKVLYLEIGIGYTT
                    **********************************:*************************

    COL             PQFVKHPFQRMTRKNENALYMTMNKKAYRIPNSIQERTIHLTEDISTLITAALRNDSTTK
    N315            PQFVKHPFQRMTRKNENAIYMTMNKKAYRIPNSIQERTIHLTEDISTLITTALRNDSTTQ
    NCTC8325        PQFVKHPFQRMTRKNENALYMTMNKKAYRIPNSIQERTIHLTEDISTLITAALRNDSTTK
    Newman          PQFVKHPFQRMTRKNENALYMTMNKKAYRIPNSIQERTIHLTEDISTLITAALRNDSTTK
    USA300_FPR3757  PQFVKHPFQRMTRKNENALYMTMNKKAYRIPNSIQERTIHLTEDISTLITAALRNDSTTK
                    ******************:*******************************:********:

    COL             NNNIGETEDVLNRTD
    N315            NNNIGETEDVLNRTD
    NCTC8325        NNNIGETEDVLNRTD
    Newman          NNNIGETEDVLNRTD
    USA300_FPR3757  NNNIGETEDVLNRTD
                    ***************