From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003930000
  • symbol?: hepT
  • description?: heptaprenyl diphosphate syntase component II

      descriptions from strain specific annotations:

    • heptaprenyl diphosphate syntase component II
    • polyprenyl synthetase
    • Heptaprenyl diphosphate synthase component II
    • heptaprenyl diphosphate synthase component 2 (HEPPPsynthase subunit 2) (Spore germination protein C3)
    • trans-hexaprenyltranstransferase subunit II
    • putative heptaprenyl diphosphate synthase subunit II
    • iron (Fe3+) ABC superfamily ATP binding cassette transporter, membrane protein
    • heptaprenyl diphosphate synthase component II (hepppsynthase subunit 2) (spore germination protein c3)
    • Farnesyl pyrophosphate synthetase
    • putative heptaprenyl diphosphate synthase component II
  • strand?: -
  • coordinates?: 4249771..4250616
  • synteny block?: BlockID0029760
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1302 (gerCC)
    NCTC8325:
    Newman:
    NWMN_1379 (hepT)
    USA300_FPR3757:
    04-02981:
    SA2981_1426 (gerCC)
    08BA02176:
    C248_1509
    11819-97:
    MS7_1424 (hepT)
    71193:
    ST398NM01_1468
    ECT-R 2:
    ECTR2_1322
    ED133:
    SAOV_1476
    ED98:
    SAAV_1457
    HO 5096 0412:
    SAEMRSA15_13300
    JH1:
    SaurJH1_1557
    JH9:
    SaurJH9_1527
    JKD6008:
    SAA6008_01438 (gerCC)
    JKD6159:
    SAA6159_01334 (gerCC)
    LGA251:
    SARLGA251_13820
    M013:
    M013TW_1417
    MRSA252:
    SAR1479
    MSHR1132:
    SAMSHR1132_13090
    MSSA476:
    SAS1411
    Mu3:
    SAHV_1458 (gerCC)
    Mu50:
    SAV1470 (gerCC)
    MW2:
    MW1359 (gerCC)
    RF122:
    SAB1332c
    ST398:
    SAPIG1468
    T0131:
    SAT0131_01558 (set20)
    TCH60:
    HMPREF0772_11736 (hepT)
    TW20:
    SATW20_14670
    USA300_TCH1516:
    USA300HOU_1407 (gerC)
    VC40:
    SAVC_06600

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ---MAKLNMNNEIKKVEQRLEKAIKSKDSVLEQASLHLLSSGGKRVRPAFVILSSQFGKD
    N315            ---MAKLNMNNEIKKVEQRLEKAIKSKDSVLEQASLHLLSSGGKRVRPAFVILSSQFGKD
    NCTC8325        --------MNNEIKKVEQRLEKAIKSKDSVLEQASLHLLSSGGKRVRPAFVILSSQFGKD
    Newman          MINVAKLNMNNEIKKVEQRLEKAIKSKDSVLEQASLHLLSSGGKRVRPAFVILSSQFGKD
    USA300_FPR3757  --------MNNEIKKVEQRLEKAIKSKDSVLEQASLHLLSSGGKRVRPAFVILSSQFGKD
                            ****************************************************

    COL             EQTSEQTYQVAVALELIHMATLVHDDVIDKSDKRRGKLTISKKWDQTTAILTGNFLLALG
    N315            EQTSEQTYQVAVALELIHMATLVHDDVIDKSDKRRGKLTISKKWDQTTAILTGNFLLALG
    NCTC8325        EQTSEQTYQVAVALELIHMATLVHDDVIDKSDKRRGKLTISKKWDQTTAILTGNFLLALG
    Newman          EQTSEQTYQVAVALELIHMATLVHDDVIDKSDKRRGKLTISKKWDQTTAILTGNFLLALG
    USA300_FPR3757  EQTSEQTYQVAVALELIHMATLVHDDVIDKSDKRRGKLTISKKWDQTTAILTGNFLLALG
                    ************************************************************

    COL             LEHLMAVKDNRVHQLISESIVDVCRGELFQFQDQFNSQQTIINYLRRINRKTALLIQIST
    N315            LEHLMAVKDNRVHQLISESIVDVCRGELFQFQDQFNSQQTIINYLRRINRKTALLIQIST
    NCTC8325        LEHLMAVKDNRVHQLISESIVDVCRGELFQFQDQFNSQQTIINYLRRINRKTALLIQIST
    Newman          LEHLMAVKDNRVHQLISESIVDVCRGELFQFQDQFNSQQTIINYLRRINRKTALLIQIST
    USA300_FPR3757  LEHLMAVKDNRVHQLISESIVDVCRGELFQFQDQFNSQQTIINYLRRINRKTALLIQIST
                    ************************************************************

    COL             EVGAITSQSDKETVRKLKMIGHYIGMSFQIIDDVLDFTSTEKKLGKPVGSDLLNGHITLP
    N315            EVGAITSQSDKETVRKLKMIGHYIGMSFQIIDDVLDFTSTEKKLGKPVGSDLLNGHITLP
    NCTC8325        EVGAITSQSDKETVRKLKMIGHYIGMSFQIIDDVLDFTSTEKKLGKPVGSDLLNGHITLP
    Newman          EVGAITSQSDKETVRKLKMIGHYIGMSFQIIDDVLDFTSTEKKLGKPVGSDLLNGHITLP
    USA300_FPR3757  EVGAITSQSDKETVRKLKMIGHYIGMSFQIIDDVLDFTSTEKKLGKPVGSDLLNGHITLP
                    ************************************************************

    COL             ILLEMRKNPDFKLKIEQLRRDSERKEFEECIQIIRKSDSIDEAKAVSSKYLSKALNLISE
    N315            ILLEMRKNPDFKLKIEQLRRDSERKEFEECIQIIRKSDSIDEAKAVSSKYLSKALNLISE
    NCTC8325        ILLEMRKNPDFKLKIEQLRRDSERKEFEECIQIIRKSDSIDEAKAVSSKYLSKALNLISE
    Newman          ILLEMRKNPDFKLKIEQLRRDSERKEFEECIQIIRKSDSIDEAKAVSSKYLSKALNLISE
    USA300_FPR3757  ILLEMRKNPDFKLKIEQLRRDSERKEFEECIQIIRKSDSIDEAKAVSSKYLSKALNLISE
                    ************************************************************

    COL             LPDGHPKSLLLSLTKKMGSRNT
    N315            LPDGHPKSLLLSLTKKMGSRNT
    NCTC8325        LPDGHPKSLLLSLTKKMGSRNT
    Newman          LPDGHPKSLLLSLTKKMGSRNT
    USA300_FPR3757  LPDGHPKSLLLSLTKKMGSRNT
                    **********************