Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004209000
  • symbol?:
  • description?: protease

      descriptions from strain specific annotations:

    • protease
    • peptidase U32
    • U32 family peptidase
    • peptidase family U32 family protein
    • peptidase U32 family protein
    • peptidase, U32 family small subunit (C1)
    • putative peptidase
    • proteinase
  • strand?: -
  • coordinates?: 4461816..4462739
  • synteny block?: BlockID0032370
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1571
    08BA02176:
    C248_1655
    11819-97:
    MS7_1629
    71193:
    ST398NM01_1677
    ECT-R 2:
    ECTR2_1462
    ED133:
    SAOV_1611
    ED98:
    SAAV_1605
    HO 5096 0412:
    SAEMRSA15_15310
    JH1:
    SaurJH1_1704
    JH9:
    SaurJH9_1670
    JKD6008:
    SAA6008_01583
    JKD6159:
    SAA6159_01546
    LGA251:
    SARLGA251_15160
    M013:
    M013TW_1632
    MRSA252:
    SAR1692
    MSHR1132:
    SAMSHR1132_14500
    MSSA476:
    SAS1549
    Mu3:
    SAHV_1600
    Mu50:
    SAV1613
    MW2:
    MW1563
    RF122:
    SAB1484c
    ST398:
    SAPIG1677
    T0131:
    SAT0131_01710 (tuf)
    TCH60:
    HMPREF0772_11528
    TW20:
    SATW20_16080
    USA300_TCH1516:
    USA300HOU_1613
    VC40:
    SAVC_07315

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTELLVTPKSLSHMETLIDLGADAFVIGEQKFGLRLPGEFNRQQMTEAVALAHKNDKKVY
    N315            MTELLVTPKSLSHMETLIDLGADAFVIGEQKFGLRLPGEFNRQQMTEAVALAHKNDKKVY
    NCTC8325        MTELLVTPKSLSHMETLIDLGADAFVIGEQKFGLRLPGEFNRQQMTEAVALAHKNDKKVY
    Newman          MTELLVTPKSLSHMETLIDLGADAFVIGEQKFGLRLPGEFNRQQMTEAVALAHKNDKKVY
    USA300_FPR3757  MTELLVTPKSLSHMETLIDLGADAFVIGEQKFGLRLPGEFNRQQMTEAVALAHKNDKKVY
                    ************************************************************

    COL             AAVNGLFHNYHLDAVEDYINFLHEIRVDRIIFGDPAVVMYVKAQENPIPLHWNAETLVTN
    N315            AAVNGLFHNYHLDAVEDYINFLHEIRVDRIIFGDPAVVMYVKAQENPIPLHWNAETLVTN
    NCTC8325        AAVNGLFHNYHLDAVEDYINFLHEIRVDRIIFGDPAVVMYVKAQENPIPLHWNAETLVTN
    Newman          AAVNGLFHNYHLDAVEDYINFLHEIRVDRIIFGDPAVVMYVKAQENPIPLHWNAETLVTN
    USA300_FPR3757  AAVNGLFHNYHLDAVEDYINFLHEIRVDRIIFGDPAVVMYVKAQENPIPLHWNAETLVTN
                    ************************************************************

    COL             HFQCNYWGKRGASRAVLARELNLDEIINIKENSNVEIEVQVQGMTCMFQSKRMLLGNYYT
    N315            HFQCNYWGKRGASRAVLARELNLDEIINIKENSNVEIEVQVQGMTCMFQSKRMLLGNYYT
    NCTC8325        HFQCNYWGKRGASRAVLARELNLDEIINIKENSNVEIEVQVQGMTCMFQSKRMLLGNYYT
    Newman          HFQCNYWGKRGASRAVLARELNLDEIINIKENSNVEIEVQVQGMTCMFQSKRMLLGNYYT
    USA300_FPR3757  HFQCNYWGKRGASRAVLARELNLDEIINIKENSNVEIEVQVQGMTCMFQSKRMLLGNYYT
                    ************************************************************

    COL             FQDRQMKIERRNDEQSLLLYDEERQNNYPVYEDYNGTHIMSPNDICLIEELAPFFEAGID
    N315            FQDRQMKIERRNDEQSLLLYDEERQNNYPVYEDYNGTHIMSPNDICLIEELAPFFEAGID
    NCTC8325        FQDRQMKIERRNDEQSLLLYDEERQNNYPVYEDYNGTHIMSPNDICLIEELAPFFEAGID
    Newman          FQDRQMKIERRNDEQSLLLYDEERQNNYPVYEDYNGTHIMSPNDICLIEELAPFFEAGID
    USA300_FPR3757  FQDRQMKIERRNDEQSLLLYDEERQNNYPVYEDYNGTHIMSPNDICLIEELAPFFEAGID
                    ************************************************************

    COL             SFKIDGILQTEEYINVVTEQYRQAIDLYNEDPEIYEDEKFMLMDPIEEIQPDHRPFDEGF
    N315            SFKIDGILQTEEYINVVTEQYRQAIDLYNEDPEIYEDEKFMLIDPIEEIQPDHRPFDEGF
    NCTC8325        SFKIDGILQTEEYINVVTEQYRQAIDLYNEDPEIYEDEKFMLMDPIEEIQPDHRPFDEGF
    Newman          SFKIDGILQTEEYINVVTEQYRQAIDLYNEDPEIYEDEKFMLMDPIEEIQPDHRPFDEGF
    USA300_FPR3757  SFKIDGILQTEEYINVVTEQYRQAIDLYNEDPEIYEDEKFMLMDPIEEIQPDHRPFDEGF
                    ******************************************:*****************

    COL             LYKQTVY
    N315            LYKQTVY
    NCTC8325        LYKQTVY
    Newman          LYKQTVY
    USA300_FPR3757  LYKQTVY
                    *******