From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006446000
  • symbol?:
  • description?: sulfurtransferase

      descriptions from strain specific annotations:

    • sulfurtransferase
    • rhodanese-like domain-containing protein
    • rhodanese domain sulfurtransferase
    • rhodanese family protein
    • putative rhodanese-related sulfurtransferase
    • protein_2622
    • Rhodanese-related sulfurtransferase
    • Rhodanese domain protein
  • strand?: +
  • coordinates?: 6490516..6491472
  • synteny block?: BlockID0051530
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2629
    08BA02176:
    C248_2753
    11819-97:
    MS7_2695
    71193:
    ST398NM01_2735
    ECT-R 2:
    ECTR2_2542
    ED133:
    SAOV_2735
    ED98:
    SAAV_2763
    HO 5096 0412:
    SAEMRSA15_25900
    JH1:
    SaurJH1_2770
    JH9:
    SaurJH9_2713
    JKD6008:
    SAA6008_02748
    JKD6159:
    SAA6159_02586
    LGA251:
    SARLGA251_24570
    M013:
    M013TW_2672
    MRSA252:
    SAR2771
    MSHR1132:
    SAMSHR1132_25180
    MSSA476:
    SAS2575
    Mu3:
    SAHV_2673
    Mu50:
    SAV2689
    MW2:
    MW2609
    RF122:
    SAB2565
    ST398:
    SAPIG2735
    T0131:
    SAT0131_02968
    TCH60:
    HMPREF0772_10497
    TW20:
    SATW20_28260
    USA300_TCH1516:
    USA300HOU_2691
    VC40:
    SAVC_12320

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNYQVLLYYKYMTIDDPEQFAQDHLAFCKAHHLKGRILVSTEGINGTLSGTKEETEQYMA
    N315            MNYQVLLYYKYTTIDDPEQFAQDHLAFCKAHHLKGRILVSTEGINGTLSGTKEETEQYMA
    NCTC8325        MNYQVLLYYKYMTIDDPEQFAQDHLAFCKAHHLKGRILVSTEGINGTLSGTKEETEQYMA
    Newman          MNYQVLLYYKYMTIDDPEQFAQDHLAFCKAHHLKGRILVSTEGINGTLSGTKEETEQYMA
    USA300_FPR3757  MNYQVLLYYKYMTIDDPEQFAQDHLAFCKAHHLKGRILVSTEGINGTLSGTKEETEQYMA
                    *********** ************************************************

    COL             HMHADERFKDMVFKIDEAEGHAFKKMHVRPRKEIVALDLEDDVDPRHTTGQYLSPVEFRK
    N315            HMHADERFKDMVFKIDEAEGHAFKKMHVRPRKEIVALDLEDDVDPRHTTGQYLSPVEFRK
    NCTC8325        HMHADERFKDMVFKIDEAEGHAFKKMHVRPRKEIVALDLEDDVDPRHTTGQYLSPVEFRK
    Newman          HMHADERFKDMVFKIDEAEGHAFKKMHVRPRKEIVALDLEDDVDPRHTTGQYLSPVEFRK
    USA300_FPR3757  HMHADERFKDMVFKIDEAEGHAFKKMHVRPRKEIVALDLEDDVDPRHTTGQYLSPVEFRK
                    ************************************************************

    COL             ALEDDDTVIIDARNDYEFDLGHFRGAIRPNITRFRDLPDWIKENKALFADKKVVTYCTGG
    N315            ALEDDDTVIIDARNDYEFDLGHFRGAIRPDITRFRDLPDWIKENKALFTDKKVVTYCTGG
    NCTC8325        ALEDDDTVIIDARNDYEFDLGHFRGAIRPNITRFRDLPDWIKENKALFADKKVVTYCTGG
    Newman          ALEDDDTVIIDARNDYEFDLGHFRGAIRPNITRFRDLPDWIKENKALFADKKVVTYCTGG
    USA300_FPR3757  ALEDDDTVIIDARNDYEFDLGHFRGAIRPNITRFRDLPDWIKENKALFADKKVVTYCTGG
                    *****************************:******************:***********

    COL             IRCEKFSGWLLKEGFEDVAQLHGGIATYGKDPETKSEYWDGKMYVFDDRISVDINQVEKT
    N315            IRCEKFSGWLLKEGFEDVAQLHGGIATYGKDPETKGQYWDGKMYVFDDRISVDINQVEKT
    NCTC8325        IRCEKFSGWLLKEGFEDVAQLHGGIATYGKDPETKGEYWDGKMYVFDDRISVDINQVEKT
    Newman          IRCEKFSGWLLKEGFEDVAQLHGGIATYGKDPETKGEYWDGKMYVFDDRISVDINQVEKT
    USA300_FPR3757  IRCEKFSGWLLKEGFEDVAQLHGGIATYGKDPETKGEYWDGKMYVFDDRISVDINQVEKT
                    ***********************************.:***********************

    COL             IIGKDWFDGKPCERYINCANPECNKQILVSEENETKYLGACSYECAKHERNRYVQANNIS
    N315            IIGKDWFDGKPCERYINCANPECNKQILVSEENETKYLGACSYECAKHERNRYVQANNIS
    NCTC8325        IIGKDWFDGKPCERYINCANPECNKQILVSEENETKYLGACSYECAKHERNRYVQANNIS
    Newman          IIGKDWFDGKPCERYINCANPECNKQILVSEENETKYLGACSYECAKHERNRYVQANNIS
    USA300_FPR3757  IIGKDWFDGKPCERYINCANPECNKQILVSEENETKYLGACSYECAKHERNRYVQANNIS
                    ************************************************************

    COL             DNEWQQRLTNFDDLHQHA
    N315            DNEWQQRLTNFDDLHQHA
    NCTC8325        DNEWQQRLTNFDDLHQHA
    Newman          DNEWQQRLTNFDDLHQHA
    USA300_FPR3757  DNEWQQRLTNFDDLHQHA
                    ******************