From AureoWiki
Jump to: navigation, search

NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS04460 [old locus tag: SA0781 ]
  • pan locus tag?: SAUPAN003016000
  • symbol: SA_RS04460
  • pan gene symbol?:
  • synonym:
  • product: nitronate monooxygenase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS04460 [old locus tag: SA0781 ]
  • symbol: SA_RS04460
  • product: nitronate monooxygenase
  • replicon: chromosome
  • strand: +
  • coordinates: 887700..888767
  • length: 1068
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002745 (887700..888767) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    ATGTGGAATAAGAATCGACTTACTCAAATGTTAAGTATTGAATATCCAATTATACAAGCA
    GGTATGGCAGGAAGTACGACACCGAAATTAGTTGCATCAGTAAGTAACAGTGGTGGGTTA
    GGCACAATAGGCGCAGGTTACTTTAATACGCAGCAATTGGAAGATGAAATAGATTATGTA
    CGCCAATTAACGTCAAATTCTTTTGGCGTAAATGTCTTTGTACCAAGTCAACAATCATAT
    ACCAGTAGTCAAATTGAAAATATGAATGCATGGTTAAAACCTTATCGACGCGCATTACAT
    TTAGAAGAGCCGGTTGTAAAAATTATCGAAGAACAACAATTTAAGTGTCATATTGATACG
    ATAATTAAAAAGCAAGTGCCTGTATGTTGTTTTACTTTTGGAATTCCAAATGAATCTATT
    ATAGAAAGATTGAAAGAAGCAAACATTAAGCTAATAGGTACAGCAACAAGTGTTGATGAA
    GCTATTGCGAATGAAAAAGCGGGTATGGATGCTATCGTTGCTCAAGGTAGTGAAGCAGGT
    GGACATCGTGGTTCATTTTTAAAACCTAAAAATCAATTACCTATGGTTGGAACAATATCT
    TTAGTGCCACAAATTGTAGATGTCGTTTCAATTCCGGTCATTGCCGCTGGTGGAATTATG
    GACGGTAGAGGAGTTTTGGCAAGTATTGTCTTAGGTGCAGAAGGGGTACAAATGGGCACT
    GCATTTTTAACATCACAAGATAGTAATGCATCAGAACTACTACGAGACGCAATTATAAAT
    AGTAAAGAAACAGATACAGTCGTTACAAAAGCGTTTAGTGGAAAGCTTGCACGCGGTATC
    AACAATAGGTTTATCGAAGAAATGTCCCAATACGAAGGCGATATCCCAGATTATCCAATA
    CAAAATGAGCTAACAAGTAGCATAAGAAAAGCCGCAGCAAACATCGGCGACAAAGAGTTA
    ACACATATGTGGAGTGGACAAAGCCCGCGACTAGCAACAACGCATCCCGCCAACACCATC
    ATGTCCAATATAATCAATCAAATTAATCAAATCATGCAATATAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1068

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA_RS04460 [old locus tag: SA0781 ]
  • symbol: SA_RS04460
  • description: nitronate monooxygenase
  • length: 355
  • theoretical pI: 5.71943
  • theoretical MW: 38633.9
  • GRAVY: -0.12507

Function[edit source | edit]

  • reaction:
    EC 1.13.12.16?  ExPASy
    Nitronate monooxygenaseEthylnitronate + O2 = acetaldehyde + nitrite + other products
  • TIGRFAM:
    putative enoyl-[acyl-carrier-protein] reductase II (TIGR03151; EC 1.3.1.-; HMM-score: 236.3)
    and 8 more
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPurine ribonucleotide biosynthesisinosine-5'-monophosphate dehydrogenase (TIGR01302; EC 1.1.1.205; HMM-score: 31.2)
    PfaD family protein (TIGR02814; HMM-score: 27.8)
    dihydroorotate dehydrogenase family protein (TIGR01037; EC 1.3.-.-; HMM-score: 24.8)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOtherisopentenyl-diphosphate delta-isomerase, type 2 (TIGR02151; EC 5.3.3.2; HMM-score: 19)
    Unknown functionGeneralIMP dehydrogenase family protein (TIGR01304; HMM-score: 17.3)
    heme/flavin dehydrogenase, mycofactocin system (TIGR03966; EC 1.-.-.-; HMM-score: 15.4)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPyrimidine ribonucleotide biosynthesisdihydroorotate dehydrogenase (fumarate) (TIGR01036; EC 1.3.98.1; HMM-score: 12.3)
    glycosyl amidation-associated protein WbuZ (TIGR03572; HMM-score: 12.1)
  • TheSEED:
  • PFAM:
    TIM_barrel (CL0036) NMO; Nitronate monooxygenase (PF03060; HMM-score: 306.5)
    and 7 more
    IMPDH; IMP dehydrogenase / GMP reductase domain (PF00478; HMM-score: 35.7)
    FMN_dh; FMN-dependent dehydrogenase (PF01070; HMM-score: 30.3)
    DHO_dh; Dihydroorotate dehydrogenase (PF01180; HMM-score: 23.6)
    Glu_synthase; Conserved region in glutamate synthase (PF01645; HMM-score: 23)
    DUF561; Protein of unknown function (DUF561) (PF04481; HMM-score: 16.6)
    His_biosynth; Histidine biosynthesis protein (PF00977; HMM-score: 13.7)
    MurF-HprK_N (CL0365) Hpr_kinase_N; HPr Serine kinase N terminus (PF02603; HMM-score: 13.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: FMN
  • effectors:
  • protein partners:
    SA_RS01275formate acetyltransferase  [1] (data from MRSA252)
    SA_RS01365L-lactate dehydrogenase  [1] (data from MRSA252)
    SA_RS01960acetyl-CoA acyltransferase  [1] (data from MRSA252)
    SA_RS02640ribose-phosphate pyrophosphokinase  [1] (data from MRSA252)
    SA_RS02710cysteine synthase  [1] (data from MRSA252)
    SA_RS0291550S ribosomal protein L10  [1] (data from MRSA252)
    SA_RS02930DNA-directed RNA polymerase subunit beta  [1] (data from MRSA252)
    SA_RS0295030S ribosomal protein S7  [1] (data from MRSA252)
    SA_RS02960elongation factor Tu  [1] (data from MRSA252)
    SA_RS03645hypothetical protein  [1] (data from MRSA252)
    SA_RS04140aldehyde dehydrogenase  [1] (data from MRSA252)
    SA_RS04160enolase  [1] (data from MRSA252)
    SA_RS04575NADH dehydrogenase  [1] (data from MRSA252)
    SA_RS05350pyruvate dehydrogenase E1 component subunit alpha  [1] (data from MRSA252)
    SA_RS05360dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex  [1] (data from MRSA252)
    SA_RS0622530S ribosomal protein S2  [1] (data from MRSA252)
    SA_RS06235elongation factor Ts  [1] (data from MRSA252)
    SA_RS06730aconitate hydratase  [1] (data from MRSA252)
    SA_RS07205serine/threonine dehydratase  [1] (data from MRSA252)
    SA_RS07955molecular chaperone DnaK  [1] (data from MRSA252)
    SA_RS08505aldehyde dehydrogenase  [1] (data from MRSA252)
    SA_RS08560pyruvate kinase  [1] (data from MRSA252)
    SA_RS08625universal stress protein UspA  [1] (data from MRSA252)
    SA_RS10535molecular chaperone GroEL  [1] (data from MRSA252)
    SA_RS10855D-alanine--D-alanine ligase  [1] (data from MRSA252)
    SA_RS11010uracil phosphoribosyltransferase  [1] (data from MRSA252)
    SA_RS1160030S ribosomal protein S9  [1] (data from MRSA252)
    SA_RS1160550S ribosomal protein L13  [1] (data from MRSA252)
    SA_RS1168030S ribosomal protein S5  [1] (data from MRSA252)
    SA_RS1169050S ribosomal protein L6  [1] (data from MRSA252)
    SA_RS1172030S ribosomal protein S17  [1] (data from MRSA252)
    SA_RS1175050S ribosomal protein L2  [1] (data from MRSA252)
    SA_RS1175550S ribosomal protein L23  [1] (data from MRSA252)
    SA_RS1176050S ribosomal protein L4  [1] (data from MRSA252)
    SA_RS13735malate:quinone oxidoreductase  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.216
    • Ymax_pos: 23
    • Cmax: 0.12
    • Cmax_pos: 34
    • Smax: 0.538
    • Smax_pos: 19
    • Smean: 0.302
    • D: 0.249
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446189381 NCBI
  • RefSeq: WP_000267236 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MWNKNRLTQMLSIEYPIIQAGMAGSTTPKLVASVSNSGGLGTIGAGYFNTQQLEDEIDYVRQLTSNSFGVNVFVPSQQSYTSSQIENMNAWLKPYRRALHLEEPVVKIIEEQQFKCHIDTIIKKQVPVCCFTFGIPNESIIERLKEANIKLIGTATSVDEAIANEKAGMDAIVAQGSEAGGHRGSFLKPKNQLPMVGTISLVPQIVDVVSIPVIAAGGIMDGRGVLASIVLGAEGVQMGTAFLTSQDSNASELLRDAIINSKETDTVVTKAFSGKLARGINNRFIEEMSQYEGDIPDYPIQNELTSSIRKAAANIGDKELTHMWSGQSPRLATTHPANTIMSNIINQINQIMQYK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA_RS04460 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]