From AureoWiki
Jump to navigation Jump to search

NCBI: 06-JUL-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2258 [new locus tag: NWMN_RS13005 ]
  • pan locus tag?: SAUPAN005864000
  • symbol: tcaR
  • pan gene symbol?: tcaR
  • synonym:
  • product: teicoplanin resistance operon transcriptional regulator TcaR

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_2258 [new locus tag: NWMN_RS13005 ]
  • symbol: tcaR
  • product: teicoplanin resistance operon transcriptional regulator TcaR
  • replicon: chromosome
  • strand: -
  • coordinates: 2481279..2481734
  • length: 456
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGGTAAAACATTTACAAGACCATATTCAATTTTTAGAGCAGTTTATAAATAACGTTAAC
    GCATTAACTGCAAAAATGTTGAAAGATTTACAAAATGAATATGAAATTTCATTAGAGCAG
    TCTAACGTATTAGGTATGTTAAATAAAGAACCTTTGACAATTAGTGAAATCACGCAAAGA
    CAAGGTGTAAATAAGGCCGCAGTAAGCCGACGAATTAAAAAGTTAATCGATGCTAAATTA
    GTTAAGTTAGATAAACCAAATTTAAATATTGATCAACGTTTGAAATTCATAACCTTAACT
    GACAAAGGTAGAGCATATTTGAAAGAACGTAATGCGATTATGACAGATATTGCGCAAGAT
    ATTACTAATGATTTAAATTCTGAAGATATTGAAAATGTAAGGCAAGTATTAGAAGTCATC
    AATCATCGCATTAAAACATATAGCAATCATAAATAG
    60
    120
    180
    240
    300
    360
    420
    456

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: NWMN_2258 [new locus tag: NWMN_RS13005 ]
  • symbol: TcaR
  • description: teicoplanin resistance operon transcriptional regulator TcaR
  • length: 151
  • theoretical pI: 9.72614
  • theoretical MW: 17521.1
  • GRAVY: -0.525828

⊟Function[edit | edit source]

  • TIGRFAM:
    homoprotocatechuate degradation operon regulator, HpaR (TIGR02337; HMM-score: 27.1)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair DnaD family protein (TIGR04548; HMM-score: 23)
    and 4 more
    mobile rSAM pair MarR family regulator (TIGR04472; HMM-score: 15.3)
    RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 14)
    Signal transduction Regulatory functions DNA interactions transcriptional regulator, Acidobacterial, PadR-family (TIGR03433; HMM-score: 14)
    Cellular processes Cellular processes Sporulation and germination stage II sporulation protein E (TIGR02865; EC 3.1.3.16; HMM-score: 7.9)
  • TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
  • PFAM:
    HTH (CL0123) MarR_2; MarR family (PF12802; HMM-score: 39.4)
    and 16 more
    HTH_20; Helix-turn-helix domain (PF12840; HMM-score: 26.8)
    HTH_5; Bacterial regulatory protein, arsR family (PF01022; HMM-score: 25.7)
    HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 25)
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 23.2)
    HTH_11; HTH domain (PF08279; HMM-score: 22.5)
    MarR; MarR family (PF01047; HMM-score: 22.4)
    HTH_IclR; IclR helix-turn-helix domain (PF09339; HMM-score: 20.1)
    Rrf2; Transcriptional regulator (PF02082; HMM-score: 19.5)
    TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 19)
    HTH_34; Winged helix DNA-binding domain (PF13601; HMM-score: 18.7)
    Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 15.4)
    UPF0122; Putative helix-turn-helix protein, YlxM / p13 like (PF04297; HMM-score: 15.2)
    Peptidase_CD (CL0093) Peptidase_C11; Clostripain family (PF03415; HMM-score: 15)
    HTH (CL0123) HTH_45; Winged helix-turn-helix (PF14947; HMM-score: 14.1)
    Globin (CL0090) Protoglobin; Protoglobin (PF11563; HMM-score: 13.4)
    no clan defined ZapB; Cell division protein ZapB (PF06005; HMM-score: 11.5)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002355
    • TAT(Tat/SPI): 0.000213
    • LIPO(Sec/SPII): 0.000279
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MVKHLQDHIQFLEQFINNVNALTAKMLKDLQNEYEISLEQSNVLGMLNKEPLTISEITQRQGVNKAAVSRRIKKLIDAKLVKLDKPNLNIDQRLKFITLTDKGRAYLKERNAIMTDIAQDITNDLNSEDIENVRQVLEVINHRIKTYSNHK

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator: SigB (activation) regulon
    SigB(sigma factor)controlling a large regulon involved in stress/starvation response and adaptation;  [1]   other strains

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Bettina Schulthess, Dominik A Bloes, Patrice François, Myriam Girard, Jacques Schrenzel, Markus Bischoff, Brigitte Berger-Bächi
    The σB-dependent yabJ-spoVG operon is involved in the regulation of extracellular nuclease, lipase, and protease expression in Staphylococcus aureus.
    J Bacteriol: 2011, 193(18);4954-62
    [PubMed:21725011] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=NWMN_2258&oldid=70475"