From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_2303 [new locus tag: SAUSA300_RS12730 ]
  • pan locus tag?: SAUPAN005864000
  • symbol: tcaR
  • pan gene symbol?: tcaR
  • synonym:
  • product: transcriptional regulator TcaR

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_2303 [new locus tag: SAUSA300_RS12730 ]
  • symbol: tcaR
  • product: transcriptional regulator TcaR
  • replicon: chromosome
  • strand: -
  • coordinates: 2476345..2476800
  • length: 456
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGGTAAAACATTTACAAGACCATATTCAATTTTTAGAGCAGTTTATAAATAACGTTAAC
    GCATTAACTGCAAAAATGTTGAAAGATTTACAAAATGAATATGAAATTTCATTAGAGCAG
    TCTAACGTATTAGGTATGTTAAATAAAGAACCTTTGACAATTAGTGAAATCACGCAAAGA
    CAAGGTGTAAATAAGGCCGCAGTAAGCCGACGAATTAAAAAGTTAATCGATGCTAAATTA
    GTTAAGTTAGATAAACCAAATTTAAATATTGATCAACGTTTGAAATTCATAACCTTAACT
    GACAAAGGTAGAGCATATTTGAAAGAACGTAATGCGATTATGACAGATATTGCGCAAGAT
    ATTACTAATGATTTAAATTCTGAAGATATTGAAAATGTAAGGCAAGTATTAGAAGTCATC
    AATCATCGCATTAAAACATATAGCAATCATAAATAG
    60
    120
    180
    240
    300
    360
    420
    456


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_2303 [new locus tag: SAUSA300_RS12730 ]
  • symbol: TcaR
  • description: transcriptional regulator TcaR
  • length: 151
  • theoretical pI: 9.72614
  • theoretical MW: 17521.1
  • GRAVY: -0.525828

Function[edit | edit source]

  • TIGRFAM:
    homoprotocatechuate degradation operon regulator, HpaR (TIGR02337; HMM-score: 27.1)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair DnaD family protein (TIGR04548; HMM-score: 23)
    and 4 more
    mobile rSAM pair MarR family regulator (TIGR04472; HMM-score: 15.3)
    RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 14)
    Signal transduction Regulatory functions DNA interactions transcriptional regulator, Acidobacterial, PadR-family (TIGR03433; HMM-score: 14)
    Cellular processes Cellular processes Sporulation and germination stage II sporulation protein E (TIGR02865; EC 3.1.3.16; HMM-score: 7.9)
  • TheSEED  :
    • Teicoplanin-resistance associated HTH-type transcriptional regulator TcaR
    Regulation and Cell signaling Quorum sensing and biofilm formation Biofilm formation in Staphylococcus  Teicoplanin-resistance associated HTH-type transcriptional regulator TcaR
    and 1 more
    Virulence, Disease and Defense Resistance to antibiotics and toxic compounds Teicoplanin-resistance in Staphylococcus  Teicoplanin-resistance associated HTH-type transcriptional regulator TcaR
  • PFAM:
    HTH (CL0123) MarR_2; MarR family (PF12802; HMM-score: 39.1)
    and 19 more
    HTH_20; Helix-turn-helix domain (PF12840; HMM-score: 28.2)
    HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 27.9)
    HTH_5; Bacterial regulatory protein, arsR family (PF01022; HMM-score: 27)
    Staph_reg_Sar_Rot; Transcriptional regulator SarA/Rot (PF22381; HMM-score: 23.8)
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 23.1)
    MarR; MarR family (PF01047; HMM-score: 22.8)
    HTH_11; HTH domain (PF08279; HMM-score: 21.6)
    Rrf2; Iron-dependent Transcriptional regulator (PF02082; HMM-score: 20.1)
    TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 18.8)
    HTH_34; Winged helix DNA-binding domain (PF13601; HMM-score: 17.9)
    HTH_IclR; IclR helix-turn-helix domain (PF09339; HMM-score: 17.3)
    HemN_C; HemN C-terminal domain (PF06969; HMM-score: 16.2)
    no clan defined T4_Rnl2_C; T4 RNA ligase 2 C-terminal (PF18043; HMM-score: 15.6)
    HTH (CL0123) Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 15.4)
    UPF0122; Putative helix-turn-helix protein, YlxM / p13 like (PF04297; HMM-score: 15.2)
    Peptidase_CD (CL0093) Peptidase_C11; Clostripain family (PF03415; HMM-score: 14.9)
    HTH (CL0123) wHTH-PRTase_assc; wHTH-PRTase associated (PF24409; HMM-score: 12.7)
    HTH_Cmi2_C; Cmi2, C-terminal (PF24270; HMM-score: 12.2)
    C2H2-zf (CL0361) zf-CRD; Cysteine rich domain with multizinc binding regions (PF17979; HMM-score: 9.2)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9708
    • Cytoplasmic Membrane Score: 0.0141
    • Cell wall & surface Score: 0.0011
    • Extracellular Score: 0.014
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002355
    • TAT(Tat/SPI): 0.000213
    • LIPO(Sec/SPII): 0.000279
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MVKHLQDHIQFLEQFINNVNALTAKMLKDLQNEYEISLEQSNVLGMLNKEPLTISEITQRQGVNKAAVSRRIKKLIDAKLVKLDKPNLNIDQRLKFITLTDKGRAYLKERNAIMTDIAQDITNDLNSEDIENVRQVLEVINHRIKTYSNHK

Experimental data[edit | edit source]

  • experimentally validated: data available for COL
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]