Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_2538 [new locus tag: NWMN_RS14585 ]
- pan locus tag?: SAUPAN006370000
- symbol: NWMN_2538
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_2538 [new locus tag: NWMN_RS14585 ]
- symbol: NWMN_2538
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 2793005..2793463
- length: 459
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5332050 NCBI
- RefSeq: YP_001333572 NCBI
- BioCyc:
- MicrobesOnline: 3708140 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421TTGAAAAAACTTCTTATTACCATCGTAATTATCGTATTAATCGGAGCACTTGGGTTCGCA
ATTTATGCTGCAATAAATCATTCTACATCATCAAGTAATAACCAAGAACAAGAAAATAAA
TCTACGCATAAAAAGACAGAAACCGAAGAAAATGATCAACAAGATGATAGTGCAGACAAA
ACAGATAAAAATCAAAATAATGGCAATAACGTTACTAATGACAATCAACCATCTTCACCG
TCAAATGTTCCTAACAACCATTCAACAGTACCATCGAATACGCAACCAGCTCAGCCAAAA
GACTCAAATTCAAATAAAAATAATACTCACGGTGGTGGCAGTCAATCGTCAACAAACAAC
CAAAATAATCAACAACAGAACACACCACCTGCTAATAAATCAAATAATACCAATACGCCT
TCTAAACAAACACCTCAAGCACAATCACCTAAAAATTAA60
120
180
240
300
360
420
459
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_2538 [new locus tag: NWMN_RS14585 ]
- symbol: NWMN_2538
- description: hypothetical protein
- length: 152
- theoretical pI: 7.85378
- theoretical MW: 16361.2
- GRAVY: -1.46579
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Cell division cell division protein ZipA (TIGR02205; HMM-score: 21.3)and 10 moreTransport and binding proteins Cations and iron carrying compounds cation transporter family protein (TIGR00860; HMM-score: 15.5)Cellular processes Sporulation and germination stage III sporulation protein AG (TIGR02830; HMM-score: 15.5)heavy metal sensor kinase (TIGR01386; EC 2.7.13.3; HMM-score: 13.4)Energy metabolism Electron transport sulfocyanin (TIGR03094; HMM-score: 13)Mobile and extrachromosomal element functions Plasmid functions entry exclusion protein TrbK (TIGR04361; HMM-score: 11.9)mycoides cluster lipoprotein, LppA/P72 family (TIGR03490; HMM-score: 11.7)Cellular processes Pathogenesis putative immunoglobulin-blocking virulence protein (TIGR04526; HMM-score: 8.8)two transmembrane protein (TIGR04527; HMM-score: 8.3)Transport and binding proteins Cations and iron carrying compounds potassium uptake protein, Trk family (TIGR00934; HMM-score: 5.8)Transport and binding proteins Nucleosides, purines and pyrimidines nucleoside Transporter (TIGR00939; HMM-score: 5.4)
- TheSEED :
- FIG01108077: hypothetical protein
- PFAM: no clan defined DUF4083; Domain of unknown function (DUF4083) (PF13314; HMM-score: 18.6)SARAF; SOCE-associated regulatory factor of calcium homoeostasis (PF06682; HMM-score: 16.5)and 18 moreCytochromB561_N; Cytochrome B561, N terminal (PF09786; HMM-score: 14.4)DUF4834; Domain of unknown function (DUF4834) (PF16118; HMM-score: 14)TSPAN_4TM-like (CL0347) DUF4064; Protein of unknown function (DUF4064) (PF13273; HMM-score: 13.8)no clan defined UPF0767; UPF0767 family (PF15990; HMM-score: 13.6)TSPAN_4TM-like (CL0347) Tetraspanin; Tetraspanin family (PF00335; HMM-score: 12.5)no clan defined PsaL; Photosystem I reaction centre subunit XI (PF02605; HMM-score: 12.5)Ac76; Orf76 (Ac76) (PF05814; HMM-score: 12.1)FeoB_associated; FeoB-associated Cys-rich membrane protein (PF12669; HMM-score: 11.8)DMT (CL0184) TMEM144; Transmembrane family, TMEM144 of transporters (PF07857; HMM-score: 10.4)Transporter (CL0375) Connexin; Connexin (PF00029; HMM-score: 10.3)no clan defined DUF6520; Family of unknown function (DUF6520) (PF20130; HMM-score: 10.2)Peptidase_AD (CL0130) Presenilin; Presenilin (PF01080; HMM-score: 10.1)GPCR_A (CL0192) SID-1_RNA_chan; dsRNA-gated channel SID-1 (PF13965; HMM-score: 9.9)no clan defined Engrail_1_C_sig; Engrailed homeobox C-terminal signature domain (PF10525; HMM-score: 9.1)RBM_T3SS-Flag (CL0873) SpoIIIAH; SpoIIIAH-like protein (PF12685; HMM-score: 7.8)no clan defined DUF6080; Family of unknown function (DUF6080) (PF19558; HMM-score: 7.7)FAM176; FAM176 family (PF14851; HMM-score: 7.4)PFF1_TM; Vacuolar membrane protease, transmembrane domain (PF22251; HMM-score: 6.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Extracellular
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.05
- Cellwall Score: 0.82
- Extracellular Score: 9.13
- Internal Helix: 1
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.3505
- Cell wall & surface Score: 0.0023
- Extracellular Score: 0.6472
- LocateP: Secretory(released) (with CS)
- Prediction by SwissProt Classification: Extracellular
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: 1
- N-terminally Anchored Score: -2
- Predicted Cleavage Site: YAAINHST
- SignalP: Signal peptide SP(Sec/SPI) length 23 aa
- SP(Sec/SPI): 0.895299
- TAT(Tat/SPI): 0.002039
- LIPO(Sec/SPII): 0.084029
- Cleavage Site: CS pos: 23-24. IYA-AI. Pr: 0.4477
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKKLLITIVIIVLIGALGFAIYAAINHSTSSSNNQEQENKSTHKKTETEENDQQDDSADKTDKNQNNGNNVTNDNQPSSPSNVPNNHSTVPSNTQPAQPKDSNSNKNNTHGGGSQSSTNNQNNQQQNTPPANKSNNTNTPSKQTPQAQSPKN
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]