Jump to navigation
Jump to search
NCBI: 03-AUG-2016
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus NCTC8325
- locus tag: SAOUHSC_02973
- pan locus tag?: SAUPAN006370000
- symbol: SAOUHSC_02973
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAOUHSC_02973
- symbol: SAOUHSC_02973
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 2735412..2735870
- length: 459
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3921674 NCBI
- RefSeq: YP_501424 NCBI
- BioCyc: G1I0R-2797 BioCyc
- MicrobesOnline: 1291395 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421TTGAAAAAACTTCTTATTACCATCGTAATTATCGTATTAATCGGAGCACTTGGGTTCGCA
ATTTATGCTGCAATAAATCATTCTACATCATCAAGTAATAACCAAGAACAAGAAAATAAA
TCTACGCATAAAAAGACAGAAACCGAAGAAAATGATCAACAAGATGATAGTGCAGACAAA
ACAGATAAAAATCAAAATAATGGCAATAACGTTACTAATGACAATCAACCATCTTCACCG
TCAAATGTTCCTAACAACCATTCAACAGTACCATCGAATACGCAACCAGCTCAGCCAAAA
GACTCAAATTCAAATAAAAATAATACTCACGGTGGTGGCAGTCAATCGTCAACAAACAAC
CAAAATAATCAACAACAGAACACACCACCTGCTAATAAATCAAATAATACCAATACGCCT
TCTAAACAAACACCTCAAGCACAATCACCTAAAAATTAA60
120
180
240
300
360
420
459
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAOUHSC_02973
- symbol: SAOUHSC_02973
- description: hypothetical protein
- length: 152
- theoretical pI: 7.85378
- theoretical MW: 16361.2
- GRAVY: -1.46579
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Cell division cell division protein ZipA (TIGR02205; HMM-score: 21.3)and 10 moreTransport and binding proteins Cations and iron carrying compounds cation transporter family protein (TIGR00860; HMM-score: 15.5)Cellular processes Sporulation and germination stage III sporulation protein AG (TIGR02830; HMM-score: 15.5)heavy metal sensor kinase (TIGR01386; EC 2.7.13.3; HMM-score: 13.4)Energy metabolism Electron transport sulfocyanin (TIGR03094; HMM-score: 13)Mobile and extrachromosomal element functions Plasmid functions entry exclusion protein TrbK (TIGR04361; HMM-score: 11.9)mycoides cluster lipoprotein, LppA/P72 family (TIGR03490; HMM-score: 11.7)Cellular processes Pathogenesis putative immunoglobulin-blocking virulence protein (TIGR04526; HMM-score: 8.8)two transmembrane protein (TIGR04527; HMM-score: 8.3)Transport and binding proteins Cations and iron carrying compounds potassium uptake protein, Trk family (TIGR00934; HMM-score: 5.8)Transport and binding proteins Nucleosides, purines and pyrimidines nucleoside Transporter (TIGR00939; HMM-score: 5.4)
- TheSEED :
- FIG01108077: hypothetical protein
- PFAM: no clan defined DUF4083; Domain of unknown function (DUF4083) (PF13314; HMM-score: 18.6)SARAF; SOCE-associated regulatory factor of calcium homoeostasis (PF06682; HMM-score: 16.5)and 18 moreCytochromB561_N; Cytochrome B561, N terminal (PF09786; HMM-score: 14.4)DUF4834; Domain of unknown function (DUF4834) (PF16118; HMM-score: 14)TSPAN_4TM-like (CL0347) DUF4064; Protein of unknown function (DUF4064) (PF13273; HMM-score: 13.8)no clan defined UPF0767; UPF0767 family (PF15990; HMM-score: 13.6)TSPAN_4TM-like (CL0347) Tetraspanin; Tetraspanin family (PF00335; HMM-score: 12.5)no clan defined PsaL; Photosystem I reaction centre subunit XI (PF02605; HMM-score: 12.5)Ac76; Orf76 (Ac76) (PF05814; HMM-score: 12.1)FeoB_associated; FeoB-associated Cys-rich membrane protein (PF12669; HMM-score: 11.8)DMT (CL0184) TMEM144; Transmembrane family, TMEM144 of transporters (PF07857; HMM-score: 10.4)Transporter (CL0375) Connexin; Connexin (PF00029; HMM-score: 10.3)no clan defined DUF6520; Family of unknown function (DUF6520) (PF20130; HMM-score: 10.2)Peptidase_AD (CL0130) Presenilin; Presenilin (PF01080; HMM-score: 10.1)GPCR_A (CL0192) SID-1_RNA_chan; dsRNA-gated channel SID-1 (PF13965; HMM-score: 9.9)no clan defined Engrail_1_C_sig; Engrailed homeobox C-terminal signature domain (PF10525; HMM-score: 9.1)RBM_T3SS-Flag (CL0873) SpoIIIAH; SpoIIIAH-like protein (PF12685; HMM-score: 7.8)no clan defined DUF6080; Family of unknown function (DUF6080) (PF19558; HMM-score: 7.7)FAM176; FAM176 family (PF14851; HMM-score: 7.4)PFF1_TM; Vacuolar membrane protease, transmembrane domain (PF22251; HMM-score: 6.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Extracellular
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.05
- Cellwall Score: 0.82
- Extracellular Score: 9.13
- Internal Helix: 1
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.3505
- Cell wall & surface Score: 0.0023
- Extracellular Score: 0.6472
- LocateP: Secretory(released) (with CS)
- Prediction by SwissProt Classification: Extracellular
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: 1
- N-terminally Anchored Score: -2
- Predicted Cleavage Site: YAAINHST
- SignalP: Signal peptide SP(Sec/SPI) length 23 aa
- SP(Sec/SPI): 0.895299
- TAT(Tat/SPI): 0.002039
- LIPO(Sec/SPII): 0.084029
- Cleavage Site: CS pos: 23-24. IYA-AI. Pr: 0.4477
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKKLLITIVIIVLIGALGFAIYAAINHSTSSSNNQEQENKSTHKKTETEENDQQDDSADKTDKNQNNGNNVTNDNQPSSPSNVPNNHSTVPSNTQPAQPKDSNSNKNNTHGGGSQSSTNNQNNQQQNTPPANKSNNTNTPSKQTPQAQSPKN
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas [1] [2]
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: [3]
Multi-gene expression profiles
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
Proteomics: 2015, 15(21);3648-61
[PubMed:26224020] [WorldCat.org] [DOI] (I p) - ↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
Sci Rep: 2017, 7(1);9718
[PubMed:28887440] [WorldCat.org] [DOI] (I e) - ↑ Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
PLoS Genet: 2016, 12(4);e1005962
[PubMed:27035918] [WorldCat.org] [DOI] (I e)
