From AureoWiki
Jump to navigation Jump to search

NCBI: 03-AUG-2016

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_02973
  • pan locus tag?: SAUPAN006370000
  • symbol: SAOUHSC_02973
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_02973
  • symbol: SAOUHSC_02973
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2735412..2735870
  • length: 459
  • essential: no DEG other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    TTGAAAAAACTTCTTATTACCATCGTAATTATCGTATTAATCGGAGCACTTGGGTTCGCA
    ATTTATGCTGCAATAAATCATTCTACATCATCAAGTAATAACCAAGAACAAGAAAATAAA
    TCTACGCATAAAAAGACAGAAACCGAAGAAAATGATCAACAAGATGATAGTGCAGACAAA
    ACAGATAAAAATCAAAATAATGGCAATAACGTTACTAATGACAATCAACCATCTTCACCG
    TCAAATGTTCCTAACAACCATTCAACAGTACCATCGAATACGCAACCAGCTCAGCCAAAA
    GACTCAAATTCAAATAAAAATAATACTCACGGTGGTGGCAGTCAATCGTCAACAAACAAC
    CAAAATAATCAACAACAGAACACACCACCTGCTAATAAATCAAATAATACCAATACGCCT
    TCTAAACAAACACCTCAAGCACAATCACCTAAAAATTAA
    60
    120
    180
    240
    300
    360
    420
    459

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAOUHSC_02973
  • symbol: SAOUHSC_02973
  • description: hypothetical protein
  • length: 152
  • theoretical pI: 7.85378
  • theoretical MW: 16361.2
  • GRAVY: -1.46579

⊟Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Cell division cell division protein ZipA (TIGR02205; HMM-score: 21.3)
    and 10 more
    Metabolism Transport and binding proteins Cations and iron carrying compounds cation transporter family protein (TIGR00860; HMM-score: 15.5)
    Cellular processes Cellular processes Sporulation and germination stage III sporulation protein AG (TIGR02830; HMM-score: 15.5)
    heavy metal sensor kinase (TIGR01386; EC 2.7.13.3; HMM-score: 13.4)
    Metabolism Energy metabolism Electron transport sulfocyanin (TIGR03094; HMM-score: 13)
    Genetic information processing Mobile and extrachromosomal element functions Plasmid functions entry exclusion protein TrbK (TIGR04361; HMM-score: 11.9)
    mycoides cluster lipoprotein, LppA/P72 family (TIGR03490; HMM-score: 11.7)
    Cellular processes Cellular processes Pathogenesis putative immunoglobulin-blocking virulence protein (TIGR04526; HMM-score: 8.8)
    two transmembrane protein (TIGR04527; HMM-score: 8.3)
    Metabolism Transport and binding proteins Cations and iron carrying compounds potassium uptake protein, Trk family (TIGR00934; HMM-score: 5.8)
    Metabolism Transport and binding proteins Nucleosides, purines and pyrimidines nucleoside Transporter (TIGR00939; HMM-score: 5.4)
  • TheSEED  :
    • FIG01108077: hypothetical protein
  • PFAM:
    no clan defined DUF4083; Domain of unknown function (DUF4083) (PF13314; HMM-score: 18.5)
    DUF1510; Protein of unknown function (DUF1510) (PF07423; HMM-score: 18)
    SpoIIIAH; SpoIIIAH-like protein (PF12685; HMM-score: 16.4)
    DUF5469; Family of unknown function (DUF5469) (PF17561; HMM-score: 16.4)
    SARAF; SOCE-associated regulatory factor of calcium homoeostasis (PF06682; HMM-score: 15.4)
    and 23 more
    CytochromB561_N; Cytochrome B561, N terminal (PF09786; HMM-score: 14.6)
    Tetraspannin (CL0347) DUF4064; Protein of unknown function (DUF4064) (PF13273; HMM-score: 14.3)
    O-anti_assembly (CL0499) O-antigen_lig; O-antigen ligase like membrane protein (PF13425; HMM-score: 13.3)
    no clan defined TMEM51; Transmembrane protein 51 (PF15345; HMM-score: 13.3)
    DUF2206; Predicted membrane protein (DUF2206) (PF09971; HMM-score: 13.2)
    DUF4834; Domain of unknown function (DUF4834) (PF16118; HMM-score: 12.9)
    UPF0767; UPF0767 family (PF15990; HMM-score: 12.7)
    DUF4199; Protein of unknown function (DUF4199) (PF13858; HMM-score: 12.4)
    Ac76; Orf76 (Ac76) (PF05814; HMM-score: 12.2)
    P12; Virus attachment protein p12 family (PF12669; HMM-score: 12)
    PsaL; Photosystem I reaction centre subunit XI (PF02605; HMM-score: 11.5)
    ABC-2 (CL0181) ABC2_membrane_2; ABC-2 family transporter protein (PF12679; HMM-score: 10.9)
    DMT (CL0184) TMEM144; Transmembrane family, TMEM144 of transporters (PF07857; HMM-score: 10.8)
    no clan defined SLC12; Solute carrier family 12 (PF03522; HMM-score: 10.7)
    Transporter (CL0375) Connexin; Connexin (PF00029; HMM-score: 9.8)
    GPCR_A (CL0192) SID-1_RNA_chan; dsRNA-gated channel SID-1 (PF13965; HMM-score: 8.2)
    Cyclin (CL0065) CDK5_activator; Cyclin-dependent kinase 5 activator protein (PF03261; HMM-score: 7.9)
    OB (CL0021) tRNA_anti-like; tRNA_anti-like (PF12869; HMM-score: 7.9)
    no clan defined FAM176; FAM176 family (PF14851; HMM-score: 6.9)
    Tetraspannin (CL0347) Tetraspannin; Tetraspanin family (PF00335; HMM-score: 6.8)
    no clan defined MMM1; Maintenance of mitochondrial morphology protein 1 (PF10296; HMM-score: 5.8)
    FAM70; FAM70 protein (PF14967; HMM-score: 5.7)
    TipE; Na+ channel auxiliary subunit TipE (PF16972; HMM-score: 5.1)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.05
    • Cellwall Score: 0.82
    • Extracellular Score: 9.13
    • Internal Helix: 1
  • LocateP: Secretory(released) (with CS)
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: 1
    • N-terminally Anchored Score: -2
    • Predicted Cleavage Site: YAAINHST
  • SignalP: Signal peptide SP(Sec/SPI) length 23 aa
    • SP(Sec/SPI): 0.895299
    • TAT(Tat/SPI): 0.002039
    • LIPO(Sec/SPII): 0.084029
    • Cleavage Site: CS pos: 23-24. IYA-AI. Pr: 0.4477
  • predicted transmembrane helices (TMHMM): 1

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MKKLLITIVIIVLIGALGFAIYAAINHSTSSSNNQEQENKSTHKKTETEENDQQDDSADKTDKNQNNGNNVTNDNQPSSPSNVPNNHSTVPSNTQPAQPKDSNSNKNNTHGGGSQSSTNNQNNQQQNTPPANKSNNTNTPSKQTPQAQSPKN

⊟Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas [1] [2]
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  2. ↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  3. ↑ Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SAOUHSC_02973&oldid=69429"