From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_2574 [new locus tag: SAUSA300_RS14320 ]
  • pan locus tag?: SAUPAN006370000
  • symbol: SAUSA300_2574
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_2574 [new locus tag: SAUSA300_RS14320 ]
  • symbol: SAUSA300_2574
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2786850..2787308
  • length: 459
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    TTGAAAAAACTTCTTATTACCATCGTAATTATCGTATTAATCGGAGCACTTGGGTTCGCA
    ATTTATGCTGCAATAAATCATTCTACATCATCAAGTAATAACCAAGAACAAGAAAATAAA
    TCTACGCATAAAAAGACAGAAACCGAAGAAAATGATCAACAAGATGATAGTGCAGACAAA
    ACAGATAAAAATCAAAATAATGGCAATAACGTTACTAATGACAATCAACCATCTTCACCG
    TCAAATGTTCCTAACAACCATTCAACAGTACCATCGAATACGCAACCAGCTCAGCCAAAA
    GACTCAAATTCAAATAAAAATAATACTCACGGTGGTGGCAGTCAATCGTCAACAAACAAC
    CAAAATAATCAACAACAGAACACACCACCTGCTAATAAATCAAATAATACCAATACGCCT
    TCTAAACAAACACCTCAAGCACAATCACCTAAAAATTAA
    60
    120
    180
    240
    300
    360
    420
    459

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_2574 [new locus tag: SAUSA300_RS14320 ]
  • symbol: SAUSA300_2574
  • description: hypothetical protein
  • length: 152
  • theoretical pI: 7.85378
  • theoretical MW: 16361.2
  • GRAVY: -1.46579

Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Cell division cell division protein ZipA (TIGR02205; HMM-score: 21.3)
    and 10 more
    Metabolism Transport and binding proteins Cations and iron carrying compounds cation transporter family protein (TIGR00860; HMM-score: 15.5)
    Cellular processes Cellular processes Sporulation and germination stage III sporulation protein AG (TIGR02830; HMM-score: 15.5)
    heavy metal sensor kinase (TIGR01386; EC 2.7.13.3; HMM-score: 13.4)
    Metabolism Energy metabolism Electron transport sulfocyanin (TIGR03094; HMM-score: 13)
    Genetic information processing Mobile and extrachromosomal element functions Plasmid functions entry exclusion protein TrbK (TIGR04361; HMM-score: 11.9)
    mycoides cluster lipoprotein, LppA/P72 family (TIGR03490; HMM-score: 11.7)
    Cellular processes Cellular processes Pathogenesis putative immunoglobulin-blocking virulence protein (TIGR04526; HMM-score: 8.8)
    two transmembrane protein (TIGR04527; HMM-score: 8.3)
    Metabolism Transport and binding proteins Cations and iron carrying compounds potassium uptake protein, Trk family (TIGR00934; HMM-score: 5.8)
    Metabolism Transport and binding proteins Nucleosides, purines and pyrimidines nucleoside Transporter (TIGR00939; HMM-score: 5.4)
  • TheSEED  :
    • FIG01108077: hypothetical protein
  • PFAM:
    no clan defined DUF4083; Domain of unknown function (DUF4083) (PF13314; HMM-score: 18.6)
    SARAF; SOCE-associated regulatory factor of calcium homoeostasis (PF06682; HMM-score: 16.5)
    and 18 more
    CytochromB561_N; Cytochrome B561, N terminal (PF09786; HMM-score: 14.4)
    DUF4834; Domain of unknown function (DUF4834) (PF16118; HMM-score: 14)
    TSPAN_4TM-like (CL0347) DUF4064; Protein of unknown function (DUF4064) (PF13273; HMM-score: 13.8)
    no clan defined UPF0767; UPF0767 family (PF15990; HMM-score: 13.6)
    TSPAN_4TM-like (CL0347) Tetraspanin; Tetraspanin family (PF00335; HMM-score: 12.5)
    no clan defined PsaL; Photosystem I reaction centre subunit XI (PF02605; HMM-score: 12.5)
    Ac76; Orf76 (Ac76) (PF05814; HMM-score: 12.1)
    FeoB_associated; FeoB-associated Cys-rich membrane protein (PF12669; HMM-score: 11.8)
    DMT (CL0184) TMEM144; Transmembrane family, TMEM144 of transporters (PF07857; HMM-score: 10.4)
    Transporter (CL0375) Connexin; Connexin (PF00029; HMM-score: 10.3)
    no clan defined DUF6520; Family of unknown function (DUF6520) (PF20130; HMM-score: 10.2)
    Peptidase_AD (CL0130) Presenilin; Presenilin (PF01080; HMM-score: 10.1)
    GPCR_A (CL0192) SID-1_RNA_chan; dsRNA-gated channel SID-1 (PF13965; HMM-score: 9.9)
    no clan defined Engrail_1_C_sig; Engrailed homeobox C-terminal signature domain (PF10525; HMM-score: 9.1)
    RBM_T3SS-Flag (CL0873) SpoIIIAH; SpoIIIAH-like protein (PF12685; HMM-score: 7.8)
    no clan defined DUF6080; Family of unknown function (DUF6080) (PF19558; HMM-score: 7.7)
    FAM176; FAM176 family (PF14851; HMM-score: 7.4)
    PFF1_TM; Vacuolar membrane protease, transmembrane domain (PF22251; HMM-score: 6.8)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.05
    • Cellwall Score: 0.82
    • Extracellular Score: 9.13
    • Internal Helix: 1
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.3505
    • Cell wall & surface Score: 0.0023
    • Extracellular Score: 0.6472
  • LocateP: Secretory(released) (with CS)
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: 1
    • N-terminally Anchored Score: -2
    • Predicted Cleavage Site: YAAINHST
  • SignalP: Signal peptide SP(Sec/SPI) length 23 aa
    • SP(Sec/SPI): 0.895299
    • TAT(Tat/SPI): 0.002039
    • LIPO(Sec/SPII): 0.084029
    • Cleavage Site: CS pos: 23-24. IYA-AI. Pr: 0.4477
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKKLLITIVIIVLIGALGFAIYAAINHSTSSSNNQEQENKSTHKKTETEENDQQDDSADKTDKNQNNGNNVTNDNQPSSPSNVPNNHSTVPSNTQPAQPKDSNSNKNNTHGGGSQSSTNNQNNQQQNTPPANKSNNTNTPSKQTPQAQSPKN

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]