From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA2432 [new locus tag: SA_RS13945 ]
  • pan locus tag?: SAUPAN006370000
  • symbol: SA2432
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SA2432 [new locus tag: SA_RS13945 ]
  • symbol: SA2432
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2730739..2731197
  • length: 459
  • essential: no DEG other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    TTGAAAAAACTTCTTATTACCATCGTAATTATCGTATTAATCGGAGCACTTGGGTTCGCA
    ATTTATGCTGCAATAAATCATTCTACATCATCAAGTAATAACCAAGAACAAGAAAATAAA
    TCTACGCATAAAAAAACAGAAACCGAAGAAAATGATCAACAAGATGATAGTGCAGACAAA
    ACAGATAAAAATCAAAATAATGGCAATAACGATACTAATGACAATCAACCATCTTCACCG
    TCAAATGTTCCTAACAACCATTCAACAGTACCATCGAATACGCAACCAGCTCAGCCAAAC
    GACTCAAATTCAAATAAAAATAATACTCACGGTGGTGGCAGTCAATCGTCAACAAACAAC
    CAAAATAATCAACAACAGAACACACCACCTGCTAATAAATCAAATAATACCAATACGCCT
    TCTAAACAAACACCTCAAGCACAATCACCTAAAAATTAA
    60
    120
    180
    240
    300
    360
    420
    459

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SA2432 [new locus tag: SA_RS13945 ]
  • symbol: SA2432
  • description: hypothetical protein
  • length: 152
  • theoretical pI: 6.51339
  • theoretical MW: 16363.1
  • GRAVY: -1.51382

⊟Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Cell division cell division protein ZipA (TIGR02205; HMM-score: 19.2)
    Cellular processes Cellular processes Sporulation and germination stage III sporulation protein AG (TIGR02830; HMM-score: 15.7)
    and 9 more
    Metabolism Transport and binding proteins Cations and iron carrying compounds cation transporter family protein (TIGR00860; HMM-score: 14.7)
    heavy metal sensor kinase (TIGR01386; EC 2.7.13.3; HMM-score: 13.3)
    Metabolism Energy metabolism Electron transport sulfocyanin (TIGR03094; HMM-score: 12.9)
    Genetic information processing Mobile and extrachromosomal element functions Plasmid functions entry exclusion protein TrbK (TIGR04361; HMM-score: 11.9)
    mycoides cluster lipoprotein, LppA/P72 family (TIGR03490; HMM-score: 11.6)
    two transmembrane protein (TIGR04527; HMM-score: 9.6)
    Cellular processes Cellular processes Pathogenesis putative immunoglobulin-blocking virulence protein (TIGR04526; HMM-score: 8.3)
    Metabolism Transport and binding proteins Nucleosides, purines and pyrimidines nucleoside Transporter (TIGR00939; HMM-score: 7)
    Metabolism Transport and binding proteins Cations and iron carrying compounds potassium uptake protein, Trk family (TIGR00934; HMM-score: 6)
  • TheSEED  :
    • FIG01108077: hypothetical protein
  • PFAM:
    no clan defined DUF1510; Protein of unknown function (DUF1510) (PF07423; HMM-score: 20.7)
    DUF4083; Domain of unknown function (DUF4083) (PF13314; HMM-score: 18.5)
    DUF5469; Family of unknown function (DUF5469) (PF17561; HMM-score: 16.6)
    and 23 more
    SARAF; SOCE-associated regulatory factor of calcium homoeostasis (PF06682; HMM-score: 16)
    CytochromB561_N; Cytochrome B561, N terminal (PF09786; HMM-score: 15.6)
    Tetraspannin (CL0347) DUF4064; Protein of unknown function (DUF4064) (PF13273; HMM-score: 14.5)
    Tetraspannin; Tetraspanin family (PF00335; HMM-score: 13.7)
    O-anti_assembly (CL0499) O-antigen_lig; O-antigen ligase like membrane protein (PF13425; HMM-score: 13)
    no clan defined DUF4199; Protein of unknown function (DUF4199) (PF13858; HMM-score: 12.4)
    UPF0767; UPF0767 family (PF15990; HMM-score: 12.4)
    Ac76; Orf76 (Ac76) (PF05814; HMM-score: 12.1)
    P12; Virus attachment protein p12 family (PF12669; HMM-score: 11.9)
    DUF4834; Domain of unknown function (DUF4834) (PF16118; HMM-score: 11.7)
    PsaL; Photosystem I reaction centre subunit XI (PF02605; HMM-score: 11.5)
    SLC12; Solute carrier family 12 (PF03522; HMM-score: 10.7)
    DMT (CL0184) TMEM144; Transmembrane family, TMEM144 of transporters (PF07857; HMM-score: 10.7)
    ABC-2 (CL0181) ABC2_membrane_2; ABC-2 family transporter protein (PF12679; HMM-score: 10.7)
    Transporter (CL0375) Connexin; Connexin (PF00029; HMM-score: 9.7)
    no clan defined SpoIIIAH; SpoIIIAH-like protein (PF12685; HMM-score: 9)
    OB (CL0021) tRNA_anti-like; tRNA_anti-like (PF12869; HMM-score: 8.6)
    GPCR_A (CL0192) SID-1_RNA_chan; dsRNA-gated channel SID-1 (PF13965; HMM-score: 7.9)
    Cyclin (CL0065) CDK5_activator; Cyclin-dependent kinase 5 activator protein (PF03261; HMM-score: 7.4)
    no clan defined FAM176; FAM176 family (PF14851; HMM-score: 7)
    FAM70; FAM70 protein (PF14967; HMM-score: 6.7)
    MMM1; Maintenance of mitochondrial morphology protein 1 (PF10296; HMM-score: 6.1)
    MFS (CL0015) Nucleoside_tran; Nucleoside transporter (PF01733; HMM-score: 5.9)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 7.21
    • Cellwall Score: 1.45
    • Extracellular Score: 1.34
    • Internal Helix: 1
  • LocateP: Secretory(released) (with CS)
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: 1
    • N-terminally Anchored Score: -2
    • Predicted Cleavage Site: YAAINHST
  • SignalP: Signal peptide SP(Sec/SPI) length 23 aa
    • SP(Sec/SPI): 0.895299
    • TAT(Tat/SPI): 0.002039
    • LIPO(Sec/SPII): 0.084029
    • Cleavage Site: CS pos: 23-24. IYA-AI. Pr: 0.4477
  • predicted transmembrane helices (TMHMM): 1

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MKKLLITIVIIVLIGALGFAIYAAINHSTSSSNNQEQENKSTHKKTETEENDQQDDSADKTDKNQNNGNNDTNDNQPSSPSNVPNNHSTVPSNTQPAQPNDSNSNKNNTHGGGSQSSTNNQNNQQQNTPPANKSNNTNTPSKQTPQAQSPKN

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SA2432&oldid=69200"