From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS05320 [old locus tag: NWMN_0949 ]
  • pan locus tag?: SAUPAN003303000
  • symbol: NWMN_RS05320
  • pan gene symbol?: ptsH
  • synonym:
  • product: phosphocarrier protein HPr

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS05320 [old locus tag: NWMN_0949 ]
  • symbol: NWMN_RS05320
  • product: phosphocarrier protein HPr
  • replicon: chromosome
  • strand: +
  • coordinates: 1054832..1055098
  • length: 267
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_009641 (1054832..1055098) NCBI
  • BioCyc:
  • MicrobesOnline: see NWMN_0949

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGGAACAAAATTCATATGTAATCATCGACGAGACTGGTATTCACGCTAGACCAGCAACA
    ATGTTAGTACAAACAGCTTCAAAATTCGATTCTGATATTCAATTAGAATATAACGGTAAG
    AAAGTAAACTTAAAATCAATCATGGGTGTTATGAGCCTTGGTGTTGGTAAAGATGCTGAA
    ATTACAATTTATGCTGACGGTAGTGATGAATCTGACGCCATTCAAGCAATCAGTGACGTC
    TTATCAAAAGAAGGATTGACTAAATAA
    60
    120
    180
    240
    267

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_RS05320 [old locus tag: NWMN_0949 ]
  • symbol: NWMN_RS05320
  • description: phosphocarrier protein HPr
  • length: 88
  • theoretical pI: 4.26765
  • theoretical MW: 9495.67
  • GRAVY: -0.181818

Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Signal transduction PTS phosphocarrier, HPr family (TIGR01003; HMM-score: 113.9)
  • TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
  • PFAM:
    no clan defined PTS-HPr; PTS HPr component phosphorylation site (PF00381; HMM-score: 104)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 10
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.00474
    • TAT(Tat/SPI): 0.000465
    • LIPO(Sec/SPII): 0.001045
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MEQNSYVIIDETGIHARPATMLVQTASKFDSDIQLEYNGKKVNLKSIMGVMSLGVGKDAEITIYADGSDESDAIQAISDVLSKEGLTK

Experimental data[edit | edit source]

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 1.38 1.39 1.40 1.41 1.42 1.43 1.44 1.45 1.46 1.47 1.48 1.49 1.50 1.51 1.52 1.53 1.54 1.55 1.56 1.57 1.58 1.59 1.60 1.61 1.62 1.63 1.64 1.65 1.66 1.67 1.68 1.69 1.70 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]