Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_RS14960 [old locus tag: NWMN_2613 ]
- pan locus tag?: SAUPAN006490000
- symbol: NWMN_RS14960
- pan gene symbol?: rnpA
- synonym:
- product: ribonuclease P protein component
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_RS14960 [old locus tag: NWMN_2613 ]
- symbol: NWMN_RS14960
- product: ribonuclease P protein component
- replicon: chromosome
- strand: -
- coordinates: 2878072..2878425
- length: 354
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGTTATTGGAAAAAGCTTACCGAATTAAAAAGAATGCAGATTTTCAGAGAATATATAAA
AAAGGTCATTCTGTAGCCAACAGACAATTTGTTGTATACACTTGTAATAATAAAGAAATA
GACCATTTTCGCTTAGGTATTAGTGTTTCTAAAAAACTAGGTAATGCAGTGTTAAGAAAC
AAGATTAAAAGAGCAATACGTGAAAATTTCAAAGTACATAAGTCGCATATATTGGCCAAA
GATATTATTGTAATAGCAAGACAGCCAGCTAAAGATATGACGACTTTACAAATACAGAAT
AGTCTTGAGCACGTACTTAAAATTGCCAAAGTTTTTAATAAAAAGATTAAGTAA60
120
180
240
300
354
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_RS14960 [old locus tag: NWMN_2613 ]
- symbol: NWMN_RS14960
- description: ribonuclease P protein component
- length: 117
- theoretical pI: 11.225
- theoretical MW: 13652.2
- GRAVY: -0.417949
⊟Function[edit | edit source]
- reaction: EC 3.1.26.5? ExPASyRibonuclease P Endonucleolytic cleavage of RNA, removing 5'-extranucleotides from tRNA precursor
- TIGRFAM: Transcription RNA processing ribonuclease P protein component (TIGR00188; EC 3.1.26.5; HMM-score: 91.6)and 1 moreCell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides polysaccharide deacetylase family protein, PEP-CTERM locus subfamily (TIGR03006; HMM-score: 12.2)
- TheSEED: see NWMN_2613
- PFAM: S5 (CL0329) Ribonuclease_P; Ribonuclease P (PF00825; HMM-score: 111.6)and 1 moreno clan defined ATP-cone; ATP cone domain (PF03477; HMM-score: 14.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.8738
- Cytoplasmic Membrane Score: 0.0018
- Cell wall & surface Score: 0.0012
- Extracellular Score: 0.1233
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.00588
- TAT(Tat/SPI): 0.000385
- LIPO(Sec/SPII): 0.008883
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MLLEKAYRIKKNADFQRIYKKGHSVANRQFVVYTCNNKEIDHFRLGISVSKKLGNAVLRNKIKRAIRENFKVHKSHILAKDIIVIARQPAKDMTTLQIQNSLEHVLKIAKVFNKKIK
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
NWMN_RS01375 5'-nucleotidase, lipoprotein e(P4) family [1] (data from MRSA252) NWMN_RS02020 30S ribosomal protein S6 [1] (data from MRSA252) NWMN_RS02915 50S ribosomal protein L1 [1] (data from MRSA252) NWMN_RS02925 50S ribosomal protein L7/L12 [1] (data from MRSA252) NWMN_RS02930 methyltransferase [1] (data from MRSA252) NWMN_RS02955 30S ribosomal protein S7 [1] (data from MRSA252) NWMN_RS03640 LysR family transcriptional regulator [1] (data from MRSA252) NWMN_RS05165 mannosyl-glycoprotein endo-beta-N-acetylglucosamidase [1] (data from MRSA252) NWMN_RS05355 ribonuclease J 1 [1] (data from MRSA252) NWMN_RS06490 50S ribosomal protein L19 [1] (data from MRSA252) NWMN_RS06665 30S ribosomal protein S15 [1] (data from MRSA252) NWMN_RS07145 DNA topoisomerase 4 subunit A [1] (data from MRSA252) NWMN_RS07460 2-oxoglutarate dehydrogenase E1 component [1] (data from MRSA252) NWMN_RS07785 DNA-binding protein HU [1] (data from MRSA252) NWMN_RS08685 50S ribosomal protein L21 [1] (data from MRSA252) NWMN_RS08830 translation initiation factor IF-3 [1] (data from MRSA252) NWMN_RS08970 universal stress protein [1] (data from MRSA252) NWMN_RS09045 30S ribosomal protein S4 [1] (data from MRSA252) NWMN_RS09095 serine protease [1] (data from MRSA252) NWMN_RS12290 50S ribosomal protein L17 [1] (data from MRSA252) NWMN_RS12300 30S ribosomal protein S11 [1] (data from MRSA252) NWMN_RS12305 30S ribosomal protein S13 [1] (data from MRSA252) NWMN_RS12330 50S ribosomal protein L15 [1] (data from MRSA252) NWMN_RS12340 30S ribosomal protein S5 [1] (data from MRSA252) NWMN_RS12350 50S ribosomal protein L6 [1] (data from MRSA252) NWMN_RS12380 30S ribosomal protein S17 [1] (data from MRSA252) NWMN_RS12385 50S ribosomal protein L29 [1] (data from MRSA252) NWMN_RS12390 50S ribosomal protein L16 [1] (data from MRSA252) NWMN_RS12395 30S ribosomal protein S3 [1] (data from MRSA252) NWMN_RS12400 50S ribosomal protein L22 [1] (data from MRSA252) NWMN_RS12405 30S ribosomal protein S19 [1] (data from MRSA252) NWMN_RS12410 50S ribosomal protein L2 [1] (data from MRSA252) NWMN_RS12415 50S ribosomal protein L23 [1] (data from MRSA252) NWMN_RS12420 50S ribosomal protein L4 [1] (data from MRSA252) NWMN_RS12425 50S ribosomal protein L3 [1] (data from MRSA252) NWMN_RS12665 transcriptional regulator [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)