Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL2412 [new locus tag: SACOL_RS12655 ]
- pan locus tag?: SAUPAN005948000
- symbol: SACOL2412
- pan gene symbol?: tcyA
- synonym:
- product: amino acid ABC transporter amino acid-binding protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL2412 [new locus tag: SACOL_RS12655 ]
- symbol: SACOL2412
- product: amino acid ABC transporter amino acid-binding protein
- replicon: chromosome
- strand: -
- coordinates: 2471316..2472095
- length: 780
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3238154 NCBI
- RefSeq: YP_187215 NCBI
- BioCyc: see SACOL_RS12655
- MicrobesOnline: 913892 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721ATGAAAAGACTTTTATTTGTGATGATAGCTTTCGTTTTCATATTGGCTGCATGCGGAAAC
AATTCGTCGAAAGACAAGGAAGCTAGTAAAGATAGCAAGACAATTAATGTTGGGACTGAG
GGGACTTATGCACCATTTAGTTTCCACGATAAAGATGGTAAATTAACTGGTTACGATATT
GATGTTATTAAAGCAGTGGCTAAAGAAGAAGGTTTAAAACTTAAATTTAATGAAACTTCT
TGGGATTCTATGTTTGCAGGTTTAGACGCAGGGCGTTTTGATGTAATCGCGAACCAAGTA
GGTATTAATCCTGATAGAGAAAAGAAATATAAATTTTCTAAGCCTTACACATTCTCAAGT
GCTGTTTTAGTTATTCGTGAAAATGAAAAAGATATTAAAGATTTTGATGATGTTAAAGGT
AAGAAGTTAGCACAAACATTCACATCTAATTATGGTAAATTAGCTAAGGATAAAGGTGCT
GATATTACAAAAGTTGATGGCTTTAACCAATCAATGGATTTATTATTGTCTAAGCGTGTT
GATGGTACATTTAATGATAGTCTGTCATACTTGGATTATAAAAAACAAAAACCTAATGCT
AAGATCAAAGCAATCAAAGGTAATGCTGAACAAAGTAGATCTGCATTTGCATTTTCTAAA
AAAGCAGATGATGAAACAGTTCAAAAATTCAATGATGGCTTGAAAAAAATCGAGGAAAAC
GGTGAATTAGCTAAAATAGGTAAGAAATGGTTTGGTCAAGATGTTTCTAAATCTAAATAG60
120
180
240
300
360
420
480
540
600
660
720
780
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL2412 [new locus tag: SACOL_RS12655 ]
- symbol: SACOL2412
- description: amino acid ABC transporter amino acid-binding protein
- length: 259
- theoretical pI: 9.8833
- theoretical MW: 28903.7
- GRAVY: -0.619691
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Amino acids, peptides and amines lysine-arginine-ornithine-binding periplasmic protein (TIGR01096; HMM-score: 133.7)and 5 moreTransport and binding proteins Amino acids, peptides and amines ectoine/hydroxyectoine ABC transporter solute-binding protein EhuB (TIGR02995; HMM-score: 81.6)extracellular substrate-binding orphan protein, GRRM family (TIGR04262; HMM-score: 20)Energy metabolism Other methanol oxidation system protein MoxJ (TIGR03870; HMM-score: 19.9)Transport and binding proteins Carbohydrates, organic alcohols, and acids methanol oxidation system protein MoxJ (TIGR03870; HMM-score: 19.9)Transport and binding proteins Amino acids, peptides and amines lipoprotein, PulS/OutS family (TIGR01004; HMM-score: 11.8)
- TheSEED :
- L-Cystine ABC transporter, periplasmic cystine-binding protein TcyA
- PFAM: PBP (CL0177) SBP_bac_3; Bacterial extracellular solute-binding proteins, family 3 (PF00497; HMM-score: 203.6)and 4 moreLig_chan-Glu_bd; Ligated ion channel L-glutamate- and glycine-binding site (PF10613; HMM-score: 24.1)Phosphonate-bd; ABC transporter, phosphonate, periplasmic substrate-binding protein (PF12974; HMM-score: 21.5)no clan defined SspK; Small acid-soluble spore protein K family (PF08176; HMM-score: 13.8)PBP (CL0177) NMT1; NMT1/THI5 like (PF09084; HMM-score: 13.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 3.33
- Cellwall Score: 3.33
- Extracellular Score: 3.33
- Internal Helix: 1
- LocateP: Lipid anchored
- Prediction by SwissProt Classification: Extracellular
- Pathway Prediction: Sec-(SPII)
- Intracellular possibility: -0.33
- Signal peptide possibility: 1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: ILAACGN
- SignalP: Signal peptide LIPO(Sec/SPII) length 17 aa
- SP(Sec/SPI): 0.000389
- TAT(Tat/SPI): 0.000032
- LIPO(Sec/SPII): 0.999467
- Cleavage Site: CS pos: 17-18. LAA-CG. Pr: 0.9999
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKRLLFVMIAFVFILAACGNNSSKDKEASKDSKTINVGTEGTYAPFSFHDKDGKLTGYDIDVIKAVAKEEGLKLKFNETSWDSMFAGLDAGRFDVIANQVGINPDREKKYKFSKPYTFSSAVLVIRENEKDIKDFDDVKGKKLAQTFTSNYGKLAKDKGADITKVDGFNQSMDLLLSKRVDGTFNDSLSYLDYKKQKPNAKIKAIKGNAEQSRSAFAFSKKADDETVQKFNDGLKKIEENGELAKIGKKWFGQDVSKSK
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Lipoprotein [1] [2] [3] [4]
- quantitative data / protein copy number per cell:
- interaction partners:
SACOL1247 (acpP) acyl carrier protein [5] (data from MRSA252) SACOL2657 (arcA) arginine deiminase [5] (data from MRSA252) SACOL0842 (eno) phosphopyruvate hydratase [5] (data from MRSA252) SACOL1782 (fhs) formate--tetrahydrofolate ligase [5] (data from MRSA252) SACOL0838 (gapA1) glyceraldehyde 3-phosphate dehydrogenase [5] (data from MRSA252) SACOL2145 (glmS) glucosamine--fructose-6-phosphate aminotransferase [5] (data from MRSA252) SACOL1513 (hup) DNA-binding protein HU [5] (data from MRSA252) SACOL1741 (icd) isocitrate dehydrogenase [5] (data from MRSA252) SACOL1727 (infC) translation initiation factor IF-3 [5] (data from MRSA252) SACOL2272 (modA) molybdenum ABC transporter molybdenum-binding protein ModA [5] (data from MRSA252) SACOL1104 (pdhC) branched-chain alpha-keto acid dehydrogenase E2 [5] (data from MRSA252) SACOL1105 (pdhD) dihydrolipoamide dehydrogenase [5] (data from MRSA252) SACOL0204 (pflB) formate acetyltransferase [5] (data from MRSA252) SACOL1745 (pyk) pyruvate kinase [5] (data from MRSA252) SACOL0584 (rplA) 50S ribosomal protein L1 [5] (data from MRSA252) SACOL2236 (rplB) 50S ribosomal protein L2 [5] (data from MRSA252) SACOL2239 (rplC) 50S ribosomal protein L3 [5] (data from MRSA252) SACOL2224 (rplF) 50S ribosomal protein L6 [5] (data from MRSA252) SACOL2220 (rplO) 50S ribosomal protein L15 [5] (data from MRSA252) SACOL1725 (rplT) 50S ribosomal protein L20 [5] (data from MRSA252) SACOL1702 (rplU) 50S ribosomal protein L21 [5] (data from MRSA252) SACOL2234 (rplV) 50S ribosomal protein L22 [5] (data from MRSA252) SACOL1274 (rpsB) 30S ribosomal protein S2 [5] (data from MRSA252) SACOL2233 (rpsC) 30S ribosomal protein S3 [5] (data from MRSA252) SACOL1769 (rpsD) 30S ribosomal protein S4 [5] (data from MRSA252) SACOL2240 (rpsJ) 30S ribosomal protein S10 [5] (data from MRSA252) SACOL2214 (rpsK) 30S ribosomal protein S11 [5] (data from MRSA252) SACOL2215 (rpsM) 30S ribosomal protein S13 [5] (data from MRSA252) SACOL2235 (rpsS) 30S ribosomal protein S19 [5] (data from MRSA252) SACOL0816 (secA) preprotein translocase subunit SecA [5] (data from MRSA252) SACOL0095 (spa) immunoglobulin G binding protein A precursor [5] (data from MRSA252) SACOL1449 (sucA) 2-oxoglutarate dehydrogenase E1 component [5] (data from MRSA252) SACOL1276 (tsf) elongation factor Ts [5] (data from MRSA252) SACOL0594 (tuf) elongation factor Tu [5] (data from MRSA252) SACOL0721 hypothetical protein [5] (data from MRSA252) SACOL1952 ferritins family protein [5] (data from MRSA252) SACOL2173 alkaline shock protein 23 [5] (data from MRSA252) SACOL2569 1-pyrroline-5-carboxylate dehydrogenase [5] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: CymR* (repression) regulon
CymR* (TF) important in Cysteine metabolism; RegPrecise
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: 17.38 h [6]
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
J Proteome Res: 2010, 9(3);1579-90
[PubMed:20108986] [WorldCat.org] [DOI] (I p) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ 5.00 5.01 5.02 5.03 5.04 5.05 5.06 5.07 5.08 5.09 5.10 5.11 5.12 5.13 5.14 5.15 5.16 5.17 5.18 5.19 5.20 5.21 5.22 5.23 5.24 5.25 5.26 5.27 5.28 5.29 5.30 5.31 5.32 5.33 5.34 5.35 5.36 5.37 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p) - ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
Mol Cell Proteomics: 2012, 11(9);558-70
[PubMed:22556279] [WorldCat.org] [DOI] (I p)
⊟Relevant publications[edit | edit source]