Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL_RS08420 [old locus tag: SACOL1651 ]
- pan locus tag?: SAUPAN004181000
- symbol: SACOL_RS08420
- pan gene symbol?: —
- synonym:
- product: RNA-binding protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL_RS08420 [old locus tag: SACOL1651 ]
- symbol: SACOL_RS08420
- product: RNA-binding protein
- replicon: chromosome
- strand: -
- coordinates: 1681097..1681387
- length: 291
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGCTTACTGGCAAACAAAAAAGATACTTAAGAAGTTTAGCACACAATATTGATCCGATT
TTTCAAATTGGAAAAGGCGGTATCAACGAAAATATGATTAAACAAATAGATGATACGTTA
GAAAACAGAGAATTGATTAAAGTACATGTACTACAAAATAACTTTGATGATAAAAAAGAA
TTAGCTGAAACATTAAGCGAAGCTACTCATAGTGAATTAGTGCAAGTGATTGGATCTATG
ATAGTGATTTATAGAGAATCTAAAGATAATAAAGAAATTGAATTGCCATAA60
120
180
240
291
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL_RS08420 [old locus tag: SACOL1651 ]
- symbol: SACOL_RS08420
- description: RNA-binding protein
- length: 96
- theoretical pI: 5.65938
- theoretical MW: 11047.6
- GRAVY: -0.521875
⊟Function[edit | edit source]
- TIGRFAM: Unknown function General putative RNA-binding protein, YhbY family (TIGR00253; HMM-score: 130)
- TheSEED: see SACOL1651
- PFAM: no clan defined CRS1_YhbY; CRS1 / YhbY (CRM) domain (PF01985; HMM-score: 88.2)and 1 moreNADP_Rossmann (CL0063) NAD_Gly3P_dh_N; NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus (PF01210; HMM-score: 12.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002297
- TAT(Tat/SPI): 0.00015
- LIPO(Sec/SPII): 0.000525
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MLTGKQKRYLRSLAHNIDPIFQIGKGGINENMIKQIDDTLENRELIKVHVLQNNFDDKKELAETLSEATHSELVQVIGSMIVIYRESKDNKEIELP
⊟Experimental data[edit | edit source]
- experimentally validated: see SACOL1651
- protein localization: see SACOL1651
- quantitative data / protein copy number per cell: see SACOL1651
- interaction partners:
SACOL_RS01230 glycosyl transferase family 2 [1] (data from MRSA252) SACOL_RS01530 5'-nucleotidase, lipoprotein e(P4) family [1] (data from MRSA252) SACOL_RS02200 30S ribosomal protein S6 [1] (data from MRSA252) SACOL_RS03030 50S ribosomal protein L1 [1] (data from MRSA252) SACOL_RS03755 LysR family transcriptional regulator [1] (data from MRSA252) SACOL_RS06420 50S ribosomal protein L19 [1] (data from MRSA252) SACOL_RS07705 DNA-binding protein HU [1] (data from MRSA252) SACOL_RS08235 DEAD/DEAH box family ATP-dependent RNA helicase [1] (data from MRSA252) SACOL_RS08670 50S ribosomal protein L27 [1] (data from MRSA252) SACOL_RS08680 50S ribosomal protein L21 [1] (data from MRSA252) SACOL_RS08830 translation initiation factor IF-3 [1] (data from MRSA252) SACOL_RS08970 universal stress protein [1] (data from MRSA252) SACOL_RS09045 30S ribosomal protein S4 [1] (data from MRSA252) SACOL_RS10840 DEAD/DEAH box family ATP-dependent RNA helicase [1] (data from MRSA252) SACOL_RS11615 30S ribosomal protein S9 [1] (data from MRSA252) SACOL_RS11645 50S ribosomal protein L17 [1] (data from MRSA252) SACOL_RS11655 30S ribosomal protein S11 [1] (data from MRSA252) SACOL_RS11660 30S ribosomal protein S13 [1] (data from MRSA252) SACOL_RS11685 50S ribosomal protein L15 [1] (data from MRSA252) SACOL_RS11695 30S ribosomal protein S5 [1] (data from MRSA252) SACOL_RS11705 50S ribosomal protein L6 [1] (data from MRSA252) SACOL_RS11720 50S ribosomal protein L5 [1] (data from MRSA252) SACOL_RS11735 30S ribosomal protein S17 [1] (data from MRSA252) SACOL_RS11745 50S ribosomal protein L16 [1] (data from MRSA252) SACOL_RS11755 50S ribosomal protein L22 [1] (data from MRSA252) SACOL_RS11765 50S ribosomal protein L2 [1] (data from MRSA252) SACOL_RS11770 50S ribosomal protein L23 [1] (data from MRSA252) SACOL_RS11775 50S ribosomal protein L4 [1] (data from MRSA252) SACOL_RS11780 50S ribosomal protein L3 [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)
⊟Relevant publications[edit | edit source]