From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2499 [new locus tag: NWMN_RS14340 ]
  • pan locus tag?: SAUPAN006297000
  • symbol: ldh
  • pan gene symbol?: ldh2
  • synonym:
  • product: L-lactate dehydrogenase 2

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_2499 [new locus tag: NWMN_RS14340 ]
  • symbol: ldh
  • product: L-lactate dehydrogenase 2
  • replicon: chromosome
  • strand: -
  • coordinates: 2743830..2744789
  • length: 960
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    ATGAAAACATTTGGTAAAAAGGTTGTATTAATCGGAGATGGATCTGTAGGATCAAGCTAT
    GCCTTTGCAATGGTTACGCAAGGTGTTGCTGATGAATTTGTAATTATTGACATTGCAAAA
    GACAAAGTAAAAGCAGATGTTCAAGATTTAAACCATGGTACAGTCCACAGTCCTTCACCA
    GTTGATGTGAAAGCAGGTGAATACGAAGACTGTAAAGATGCAGATTTAGTTGTTATTACA
    GCTGGTGCACCTCAAAAGCCAGGTGAAACACGTTTACAATTAGTTGAAAAAAATACTAAG
    ATTATGAAGAGCATCGTTAAGAGTGTTATGGATAGTGGCTTTGATGGATATTTCTTAATC
    GCGGCAAACCCTGTAGACATTTTAACAAGATTTGTAAAAGAATATACTGGATTACCAGCA
    GAGCGTGTTATCGGTTCAGGTACTGTATTGGACAGTGCACGTTTACAATATTTAATTAGC
    CAAGAACTTGGTGTTGCACCTTCAAGTGTTGACGCTAGTATTATTGGCGAGCATGGTGAT
    ACTGAACTTGCAGTTTGGTCACAAGCAAATGTAGCAGGTATTTCAGTATATGACACATTA
    AAAGAACAAACTGGTAGCGAAGCTAAAGCGGAAGAAATTTATGTGAATACACGTGACGCT
    GCTTATGAAATTATCCAAGCTAAAGGGTCAACATACTATGGTATTGCATTAGCATTGATG
    CGCATTTCAAAAGCCATTTTAAATAATGAAAATAATGTCTTAAATGTTTCTATACAATTA
    GATGGTCAATATGGTGGTCACAAAGGCGTTTACCTAGGTGTACCAACATTAGTTAACCAA
    CATGGCGCAGTTAAAATTTATGAAATGCCATTAAGTGCCGAAGAACAAGCGTTGTTCGAT
    AAATCTGTTAAAACATTAGAAGATACATTTGATTCAATTAAATATTTATTAGAAGACTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_2499 [new locus tag: NWMN_RS14340 ]
  • symbol: Ldh
  • description: L-lactate dehydrogenase 2
  • length: 319
  • theoretical pI: 4.53599
  • theoretical MW: 34419.8
  • GRAVY: -0.0498433

Function[edit source | edit]

  • reaction:
    EC 1.1.1.27?  ExPASy
    L-lactate dehydrogenase(S)-lactate + NAD+ = pyruvate + NADH
  • TIGRFAM:
    MetabolismEnergy metabolismAnaerobicL-lactate dehydrogenase (TIGR01771; EC 1.1.1.27; HMM-score: 420.6)
    MetabolismEnergy metabolismGlycolysis/gluconeogenesisL-lactate dehydrogenase (TIGR01771; EC 1.1.1.27; HMM-score: 420.6)
    MetabolismEnergy metabolismTCA cyclemalate dehydrogenase, NAD-dependent (TIGR01763; EC 1.1.1.37; HMM-score: 209.2)
    MetabolismEnergy metabolismTCA cyclemalate dehydrogenase, NAD-dependent (TIGR01772; EC 1.1.1.37; HMM-score: 72.2)
    malate dehydrogenase (TIGR01759; EC 1.1.1.-; HMM-score: 68.5)
    lactate dehydrogenase (TIGR01756; EC 1.1.1.27; HMM-score: 51)
    malate dehydrogenase, NAD-dependent (TIGR01758; EC 1.1.1.37; HMM-score: 47.1)
    malate dehydrogenase, NADP-dependent (TIGR01757; EC 1.1.1.82; HMM-score: 17.8)
    MetabolismAmino acid biosynthesisOtherpyrrolysine biosynthesis protein PylD (TIGR03911; HMM-score: 15.7)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersThiaminethiazole biosynthesis adenylyltransferase ThiF (TIGR02356; EC 2.7.7.73; HMM-score: 12.4)
    nucleotide sugar dehydrogenase (TIGR03026; HMM-score: 12.2)
  • TheSEED:  
    CarbohydratesFermentationFermentations: Lactate L-lactate dehydrogenase (EC 1.1.1.27) 
    FermentationFermentations: Mixed acid L-lactate dehydrogenase (EC 1.1.1.27) 
  • PFAM:
    NADP_Rossmann (CL0063) Ldh_1_N; lactate/malate dehydrogenase, NAD binding domain (PF00056; HMM-score: 153.1)
    LDH_C (CL0341) Ldh_1_C; lactate/malate dehydrogenase, alpha/beta C-terminal domain (PF02866; HMM-score: 122.2)
    NADP_Rossmann (CL0063) Sacchrp_dh_NADP; Saccharopine dehydrogenase NADP binding domain (PF03435; HMM-score: 16.6)
    NAD_binding_7; Putative NAD(P)-binding (PF13241; HMM-score: 15.4)
    UDPG_MGDP_dh_N; UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain (PF03721; HMM-score: 15.2)
    F420_oxidored; NADP oxidoreductase coenzyme F420-dependent (PF03807; HMM-score: 14.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:
    NWMN_0515(capD)polysaccharide biosynthesis protein CapD  [1] (data from MRSA252)
    NWMN_1587(citC)isocitrate dehydrogenase  [1] (data from MRSA252)
    NWMN_1483(dnaK)molecular chaperone DnaK  [1] (data from MRSA252)
    NWMN_1096(ftsZ)cell division protein FtsZ  [1] (data from MRSA252)
    NWMN_0509(fus)elongation factor G  [1] (data from MRSA252)
    NWMN_1580(gapB)glyceraldehyde 3-phosphate dehydrogenase 2  [1] (data from MRSA252)
    NWMN_1348(ilvA)threonine dehydratase  [1] (data from MRSA252)
    NWMN_0132(ipdC)indole-3-pyruvate decarboxylase  [1] (data from MRSA252)
    NWMN_2179(modA)molybdenum ABC transporter periplasmic molybdate-binding protein  [1] (data from MRSA252)
    NWMN_0961(pdhC)branched-chain alpha-keto acid dehydrogenase subunit E2  [1] (data from MRSA252)
    NWMN_0962(pdhD)dihydrolipoamide dehydrogenase  [1] (data from MRSA252)
    NWMN_0162(pflB)formate acetyltransferase  [1] (data from MRSA252)
    NWMN_0959(phdA)pyruvate dehydrogenase E1 component, alpha subunit  [1] (data from MRSA252)
    NWMN_0960(phdB)pyruvate dehydrogenase E1 component, beta subunit  [1] (data from MRSA252)
    NWMN_1592(pykA)pyruvate kinase  [1] (data from MRSA252)
    NWMN_1168(pyrH)uridylate kinase  [1] (data from MRSA252)
    NWMN_0500(rplA)50S ribosomal protein L1  [1] (data from MRSA252)
    NWMN_2149(rplB)50S ribosomal protein L2  [1] (data from MRSA252)
    NWMN_2152(rplC)50S ribosomal protein L3  [1] (data from MRSA252)
    NWMN_2151(rplD)50S ribosomal protein L4  [1] (data from MRSA252)
    NWMN_2140(rplE)50S ribosomal protein L5  [1] (data from MRSA252)
    NWMN_2137(rplF)50S ribosomal protein L6  [1] (data from MRSA252)
    NWMN_0501(rplJ)50S ribosomal protein L10  [1] (data from MRSA252)
    NWMN_2136(rplR)50S ribosomal protein L18  [1] (data from MRSA252)
    NWMN_1572(rplT)50S ribosomal protein L20  [1] (data from MRSA252)
    NWMN_2147(rplV)50S ribosomal protein L22  [1] (data from MRSA252)
    NWMN_2150(rplW)50S ribosomal protein L23  [1] (data from MRSA252)
    NWMN_1166(rpsB)30S ribosomal protein S2  [1] (data from MRSA252)
    NWMN_2146(rpsC)30S ribosomal protein S3  [1] (data from MRSA252)
    NWMN_1613(rpsD)30S ribosomal protein S4  [1] (data from MRSA252)
    NWMN_2135(rpsE)30S ribosomal protein S5  [1] (data from MRSA252)
    NWMN_2119(rpsI)30S ribosomal protein S9  [1] (data from MRSA252)
    NWMN_2127(rpsK)30S ribosomal protein S11  [1] (data from MRSA252)
    NWMN_0507(rpsL)30S ribosomal protein S12  [1] (data from MRSA252)
    NWMN_2128(rpsM)30S ribosomal protein S13  [1] (data from MRSA252)
    NWMN_0359(rpsR)30S ribosomal protein S18  [1] (data from MRSA252)
    NWMN_2148(rpsS)30S ribosomal protein S19  [1] (data from MRSA252)
    NWMN_0055(spa)immunoglobulin G binding protein A precursor (protein A)  [1] (data from MRSA252)
    NWMN_1326(sucA)2-oxoglutarate dehydrogenase E1 component  [1] (data from MRSA252)
    NWMN_1325(sucB)dihydrolipoamide succinyltransferase  [1] (data from MRSA252)
    NWMN_0510(tufA)elongation factor Tu  [1] (data from MRSA252)
    NWMN_0641hypothetical protein  [1] (data from MRSA252)
    NWMN_0811hypothetical protein  [1] (data from MRSA252)
    NWMN_1382DNA-binding protein HU  [1] (data from MRSA252)
    NWMN_1604universal stress protein family protein  [1] (data from MRSA252)
    NWMN_2086alkaline shock protein 23  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.26
    • Ymax_pos: 24
    • Cmax: 0.277
    • Cmax_pos: 31
    • Smax: 0.43
    • Smax_pos: 1
    • Smean: 0.285
    • D: 0.269
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKTFGKKVVLIGDGSVGSSYAFAMVTQGVADEFVIIDIAKDKVKADVQDLNHGTVHSPSPVDVKAGEYEDCKDADLVVITAGAPQKPGETRLQLVEKNTKIMKSIVKSVMDSGFDGYFLIAANPVDILTRFVKEYTGLPAERVIGSGTVLDSARLQYLISQELGVAPSSVDASIIGEHGDTELAVWSQANVAGISVYDTLKEQTGSEAKAEEIYVNTRDAAYEIIQAKGSTYYGIALALMRISKAILNNENNVLNVSIQLDGQYGGHKGVYLGVPTLVNQHGAVKIYEMPLSAEEQALFDKSVKTLEDTFDSIKYLLED

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 1.38 1.39 1.40 1.41 1.42 1.43 1.44 1.45 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]