From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS06075 [old locus tag: NWMN_1072 ]
  • pan locus tag?: SAUPAN003416000
  • symbol: NWMN_RS06075
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS06075 [old locus tag: NWMN_1072 ]
  • symbol: NWMN_RS06075
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1175555..1175788
  • length: 234
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (1175555..1175788) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    ATGGTTTTTAATGATTGGGAAATTAACGTTGTATACTCAGGAGAGCATGAGGTTGTAACA
    AACGAAAAGAGTTTATTTGTCATTGACGAATTTTACGATGTTGCAATCGCAATCTATTAT
    TTAGATGGAAAATTAAAAGTAGCTCATGTCAACTATGGTTCTGATTTTACAATTGACGTA
    GCTAATAAAGTTTTTGAATTGAATATTCAAAATCCAAATGTTGATGAGCATTAA
    60
    120
    180
    234

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS06075 [old locus tag: NWMN_1072 ]
  • symbol: NWMN_RS06075
  • description: hypothetical protein
  • length: 77
  • theoretical pI: 4.03259
  • theoretical MW: 8898.84
  • GRAVY: -0.0519481

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:
  • PFAM:
    no clan definedDUF4860; Domain of unknown function (DUF4860) (PF16152; HMM-score: 13.4)

Structure, modifications & interactions[edit source | edit]

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.091
    • Ymax_pos: 70
    • Cmax: 0.12
    • Cmax_pos: 25
    • Smax: 0.099
    • Smax_pos: 70
    • Smean: 0.061
    • D: 0.079
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446153777 NCBI
  • RefSeq: WP_000231632 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MVFNDWEINVVYSGEHEVVTNEKSLFVIDEFYDVAIAIYYLDGKLKVAHVNYGSDFTIDVANKVFELNIQNPNVDEH

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS06075 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17

Relevant publications[edit source | edit]