From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS12395 [old locus tag: NWMN_2146 ]
  • pan locus tag?: SAUPAN005696000
  • symbol: NWMN_RS12395
  • pan gene symbol?: rpsC
  • synonym:
  • product: 30S ribosomal protein S3

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS12395 [old locus tag: NWMN_2146 ]
  • symbol: NWMN_RS12395
  • product: 30S ribosomal protein S3
  • replicon: chromosome
  • strand: -
  • coordinates: 2371674..2372327
  • length: 654
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (2371674..2372327) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    GTGGGTCAAAAAATTAATCCAATCGGACTTCGTGTTGGTATTATCCGTGATTGGGAAGCT
    AAATGGTATGCTGAAAAAGACTTCGCTTCACTTTTACACGAAGATTTAAAAATCCGTAAA
    TTTATTGATAATGAATTAAAAGAAGCATCAGTTTCTCACGTAGAGATTGAACGTGCTGCA
    AACCGTATCAACATTGCAATTCATACTGGTAAACCTGGTATGGTAATTGGTAAAGGCGGT
    TCAGAAATCGAAAAATTACGCAACAAATTAAATGCGTTAACTGATAAAAAAGTACACATC
    AACGTAATTGAAATCAAAAAAGTTGATCTTGACGCTCGTTTAGTAGCTGAAAACATCGCA
    CGTCAATTAGAAAACCGTGCTTCATTCCGTCGTGTACAAAAACAAGCAATCACTAGAGCT
    ATGAAACTTGGTGCTAAAGGTATCAAAACTCAAGTATCTGGTCGTTTAGGCGGAGCTGAC
    ATCGCTCGTGCTGAACAATATTCAGAAGGAACTGTTCCACTTCATACGTTACGTGCTGAC
    ATCGATTATGCACACGCTGAAGCTGACACTACTTACGGTAAATTAGGCGTTAAAGTATGG
    ATTTATCGTGGAGAAGTTCTTCCTACTAAGAACACTAGTGGAGGAGGAAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    654

Protein[edit source | edit]

Protein Data Bank: 5LI0

General[edit source | edit]

  • locus tag: NWMN_RS12395 [old locus tag: NWMN_2146 ]
  • symbol: NWMN_RS12395
  • description: 30S ribosomal protein S3
  • length: 217
  • theoretical pI: 10.4222
  • theoretical MW: 24099.6
  • GRAVY: -0.428111

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationribosomal protein uS3 (TIGR01009; HMM-score: 312.7)
    Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationribosomal protein uS3 (TIGR01008; HMM-score: 113.8)
    NusA family KH domain protein, archaeal (TIGR01952; HMM-score: 20.1)
    Genetic information processingTranscriptionDegradation of RNApolyribonucleotide nucleotidyltransferase (TIGR03591; EC 2.7.7.8; HMM-score: 14.6)
  • TheSEED:
  • PFAM:
    no clan definedRibosomal_S3_C; Ribosomal protein S3, C-terminal domain (PF00189; HMM-score: 131.2)
    KH (CL0007) KH_2; KH domain (PF07650; HMM-score: 74.2)
    KH_4; KH domain (PF13083; HMM-score: 20.2)
    KH_5; NusA-like KH domain (PF13184; HMM-score: 19.3)
    KH_1; KH domain (PF00013; HMM-score: 12.9)
    no clan definedSpoOE-like; Spo0E like sporulation regulatory protein (PF09388; HMM-score: 12.5)

Structure, modifications & interactions[edit source | edit]

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.089
    • Ymax_pos: 30
    • Cmax: 0.11
    • Cmax_pos: 60
    • Smax: 0.127
    • Smax_pos: 1
    • Smean: 0.064
    • D: 0.079
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446452022 NCBI
  • RefSeq: WP_000529877 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MGQKINPIGLRVGIIRDWEAKWYAEKDFASLLHEDLKIRKFIDNELKEASVSHVEIERAANRINIAIHTGKPGMVIGKGGSEIEKLRNKLNALTDKKVHINVIEIKKVDLDARLVAENIARQLENRASFRRVQKQAITRAMKLGAKGIKTQVSGRLGGADIARAEQYSEGTVPLHTLRADIDYAHAEADTTYGKLGVKVWIYRGEVLPTKNTSGGGK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS12395 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 1.38 1.39 1.40 1.41 1.42 1.43 1.44 1.45 1.46 1.47 1.48 1.49 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]