From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS02915 [old locus tag: NWMN_0500 ]
  • pan locus tag?: SAUPAN002308000
  • symbol: NWMN_RS02915
  • pan gene symbol?: rplA
  • synonym:
  • product: 50S ribosomal protein L1

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS02915 [old locus tag: NWMN_0500 ]
  • symbol: NWMN_RS02915
  • product: 50S ribosomal protein L1
  • replicon: chromosome
  • strand: +
  • coordinates: 573204..573896
  • length: 693
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (573204..573896) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGGCTAAAAAAGGTAAAAAGTATCAAGAAGCAGCTAGTAAAGTTGACCGTACTCAGCAC
    TACAGTGTTGAAGAAGCAATTAAATTAGCTAAAGAAACAAGCATTGCTAACTTTGACGCT
    TCTGTTGAAGTTGCATTCCGTTTAGGAATTGATACACGTAAAAATGACCAACAAATCCGT
    GGTGCAGTTGTATTACCAAACGGAACTGGTAAATCACAAAGTGTATTAGTATTCGCTAAA
    GGTGACAAAATTGCTGAAGCTGAAGCAGCAGGTGCTGACTATGTAGGTGAAGCAGAATAC
    GTTCAAAAAATCCAACAAGGTTGGTTCGACTTCGATGTAGTAGTTGCTACACCAGACATG
    ATGGGTGAAGTTGGTAAATTAGGTCGTGTATTAGGACCAAAAGGTTTAATGCCAAACCCT
    AAAACTGGAACTGTAACAATGGATGTTAAAAAAGCTGTTGAAGAAATCAAAGCTGGTAAA
    GTAGAATATCGTGCTGAAAAAGCTGGTATCGTACATGCATCAATTGGTAAAGTTTCATTT
    ACTGATGAACAATTAATTGAAAACTTCAATACTTTACAAGATGTATTAGCTAAAGCTAAA
    CCATCATCTGCTAAAGGTACATACTTCAAATCTGTTGCTGTAACTACAACAATGGGTCCT
    GGAGTTAAAATTGATACTGCAAGTTTCAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    693

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS02915 [old locus tag: NWMN_0500 ]
  • symbol: NWMN_RS02915
  • description: 50S ribosomal protein L1
  • length: 230
  • theoretical pI: 9.60658
  • theoretical MW: 24708.1
  • GRAVY: -0.29087

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationribosomal protein uL1 (TIGR01169; HMM-score: 352.6)
    Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationribosomal protein uL1, mitochondrial (TIGR01170; HMM-score: 97.6)
  • TheSEED:
  • PFAM:
    no clan definedRibosomal_L1; Ribosomal protein L1p/L10e family (PF00687; HMM-score: 185.5)
    DUF3599; Domain of unknown function (DUF3599) (PF12206; HMM-score: 13)
    Patatin (CL0323) SAT; Starter unit:ACP transacylase in aflatoxin biosynthesis (PF16073; HMM-score: 11.6)

Structure, modifications & interactions[edit source | edit]

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.123
    • Ymax_pos: 11
    • Cmax: 0.114
    • Cmax_pos: 37
    • Smax: 0.217
    • Smax_pos: 1
    • Smean: 0.137
    • D: 0.128
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446997363 NCBI
  • RefSeq: WP_001074619 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MAKKGKKYQEAASKVDRTQHYSVEEAIKLAKETSIANFDASVEVAFRLGIDTRKNDQQIRGAVVLPNGTGKSQSVLVFAKGDKIAEAEAAGADYVGEAEYVQKIQQGWFDFDVVVATPDMMGEVGKLGRVLGPKGLMPNPKTGTVTMDVKKAVEEIKAGKVEYRAEKAGIVHASIGKVSFTDEQLIENFNTLQDVLAKAKPSSAKGTYFKSVAVTTTMGPGVKIDTASFK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS02915 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 1.38 1.39 1.40 1.41 1.42 1.43 1.44 1.45 1.46 1.47 1.48 1.49 1.50 1.51 1.52 1.53 1.54 1.55 1.56 1.57 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]