From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000974000
  • symbol?: capA
  • description?: capsular polysaccharide type 5 biosynthesis protein cap5A

      descriptions from strain specific annotations:

    • capsular polysaccharide type 5 biosynthesis protein cap5A
    • capsular polysaccharide biosynthesis protein Cap5A
    • capsular polysaccharide synthesis protein Cap5A
    • capsular polysaccharide biosynthesis protein
    • capsular polysaccharide synthesis enzyme CapA
    • capsular polysaccharide synthesis enzyme Cap5A
    • capsular polysaccharide biosynthesis protein CapA
    • membrane protein CapA1
    • MPA1 family polysaccharide export protein
    • polysaccharide export protein, MPA1 family protein
    • truncated
    • truncated capsular polysaccharide synthesis enzyme Cap5A
  • strand?: +
  • coordinates?: 1230623..1231139
  • synteny block?: BlockID0005080
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0136 (cap5A)
    N315:
    SA0144 (capA)
    NCTC8325:
    Newman:
    NWMN_0095 (capA)
    USA300_FPR3757:
    SAUSA300_0152 (cap5A)
    04-02981:
    SA2981_0150 (capA)
    08BA02176:
    C248_0138 (capA)
    11819-97:
    MS7_0143
    71193:
    ST398NM01_0163
    ECT-R 2:
    ECTR2_106
    ED133:
    SAOV_0096
    ED98:
    SAAV_0117 (cap5A)
    HO 5096 0412:
    SAEMRSA15_01150 (capA)
    JH1:
    SaurJH1_0140
    JH9:
    SaurJH9_0135
    JKD6008:
    SAA6008_00127 (cap5A)
    JKD6159:
    SAA6159_00133 (cap5A)
    LGA251:
    SARLGA251_01230 (capA)
    M013:
    M013TW_0139
    MRSA252:
    SAR0151 (capA)
    MSHR1132:
    SAMSHR1132_01230
    MSSA476:
    SAS0124
    Mu3:
    SAHV_0148 (capA)
    Mu50:
    SAV0149 (capA)
    MW2:
    MW0124 (cap8A)
    RF122:
    SAB0090 (capA)
    ST398:
    SAPIG0163
    T0131:
    SAT0131_00139
    TCH60:
    HMPREF0772_10349 (cap5A)
    TW20:
    SATW20_01600 (capA)
    USA300_TCH1516:
    USA300HOU_0163 (cap5A)
    VC40:
    SAVC_00515

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MESTLELTKIKEVLQKNLKILIILPLLFLIISAIVTFFVLSPKYQANTQILVNQTKGDNP
    N315            MESTLELTKIKEVLQKNLKILIILPLLFLIISAIVTFFVLSPKYQANTQILVNQTKGDNP
    NCTC8325        MESTLELTKIKEVLQKNLKILIILPLLFLIISAIVTFFVLSPKYQANTQILVNQTKGDNP
    Newman          MESTLELTKIKEVLQKNLKILIILPLLFLIISAIVTFFVLSPKYQANTQILVNQTKGDNP
    USA300_FPR3757  MESTLELTKIKEVLQKNLKILIILPLLFLIISAIVTFFVLSPKYQANTQILVNQTKGDNP
                    ************************************************************

    COL             QFMAQEVQSNIQLVNTYKEIVKSPRILDEVSKDLNDKYSPSKLSSMLTITNQENTQLINI
    N315            QFMAQEVQSNIQLVNTYKEIVKSPRILDEVSKDLNDKYSPSKLSSMLTITNQENTQLINI
    NCTC8325        QFMAQEVQSNIQLVNTYKEIVKSPRILDEVSKDLNDKYSPSKLSSMLTITNQENTQLINI
    Newman          QFMAQEVQSNIQLVNTYKEIVKSPRILDEVSKDLNDKYSPSKLSSMLTITNQENTQLINI
    USA300_FPR3757  QFMAQEVQSNIQLVNTYKEIVKSPRILDEVSKDLNDKYSPSKLSSMLTITNQENTQLINI
                    ************************************************************

    COL             QVKSGHKQDSEKIANSFAKVTSKQIPKIMSVDNVSILSKADGTAVKVAPKTVVNLIGAFF
    N315            QVKSGHKQDSEKIANSFAKVTSKQIPKIMSVDNVSILSKADGTAVKVAPKTVVNLIGAFF
    NCTC8325        QVKSGHKQDSEKIANSFAKVTSKQIPKIMSVDNVSILSKADGTAVKVAPKTVVNLIGAFF
    Newman          QVKSGHKQDSEKIANSFAKVTSKQIPKIMSVDNVSILSKADGTAVKVAPKTVVNLIGAFF
    USA300_FPR3757  QVKSGHKQDSEKIANSFAKVTSKQIPKIMSVDNVSILSKADGTAVKVAPKTVVNLIGAFF
                    ************************************************************

    COL             LGLVVALIYIFFKVIFDKRIKDEEDVEKELGLPVLGSIQKFN
    N315            LGLVVALIYIFFKVIFDKRIKDEEDVEKELGLPVLGSIQKFN
    NCTC8325        LGLVVALIYIFFKVIFDKRIKDEEDVEKELGLPVLGSIQKFN
    Newman          LGLVVALIYIFFKVIFDKRIKDEEDVEKELGLPVLGSIQKFN
    USA300_FPR3757  LGLVVALIYIFFKVIFDKRIKDEEDVEKELGLPVLGSIQKFN
                    ******************************************