From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001857000
  • symbol?:
  • description?: macro domain protein

      descriptions from strain specific annotations:

    • macro domain protein
    • protein in Tap1-dppD intergenic region
    • ATPase associated with chromosome architecture/replication
    • appr-1-p processing enzyme family domain protein
  • strand?: +
  • coordinates?: 2355102..2355902
  • synteny block?: BlockID0012320
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0324
    08BA02176:
    C248_0378
    11819-97:
    MS7_0315
    71193:
    ST398NM01_0405
    ECT-R 2:
    ECTR2_285
    ED133:
    SAOV_0351
    ED98:
    SAAV_0293
    HO 5096 0412:
    SAEMRSA15_02810
    JH1:
    SaurJH1_0384
    JH9:
    SaurJH9_0374
    JKD6008:
    SAA6008_00302
    JKD6159:
    SAA6159_00301
    LGA251:
    SARLGA251_02870
    M013:
    M013TW_0306
    MRSA252:
    SAR0322
    MSHR1132:
    SAMSHR1132_02990
    MSSA476:
    SAS0302
    Mu3:
    SAHV_0322
    Mu50:
    SAV0325
    MW2:
    MW0302
    RF122:
    SAB0275
    ST398:
    SAPIG0405
    T0131:
    SAT0131_00330 (folC)
    TCH60:
    HMPREF0772_10170
    TW20:
    SATW20_03930
    USA300_TCH1516:
    USA300HOU_0346
    VC40:
    SAVC_01375

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             METLKSNKARLEYLINDMHRERNDNDVLVMPSSFEDLWELYRGLANVRPALPVSDEYLAV
    N315            METLKSNKARLEYLINDMRRERNDNDVLVMPSSFEDLWELYRGLANVRPALPVSDEYLAV
    NCTC8325        METLKSNKARLEYLINDMHRERNDNDVLVMPSSFEDLWELYRGLANVRPALPVSDEYLAV
    Newman          METLKSNKARLEYLINDMHRERNDNDVLVMPSSFEDLWELYRGLANVRPALPVSDEYLAV
    USA300_FPR3757  METLKSNKARLEYLINDMHRERNDNDVLVMPSSFEDLWELYRGLANVRPALPVSDEYLAV
                    ******************:*****************************************

    COL             QDAMLSDLNRQHVTDLKDLKPIKGDNIFVWQGDITTLKIDAIVNAANSRFLGCMQANHDC
    N315            QDAMLSDLNHQHVTDLKDLKPIKGDNIFVWQGDITTLKIDAIVNAANSRFLGCMQANHDC
    NCTC8325        QDAMLSDLNRQHVTDLKDLKPIKGDNIFVWQGDITTLKIDAIVNAANSRFLGCMQANHDC
    Newman          QDAMLSDLNRQHVTDLKDLKPIKGDNIFVWQGDITTLKIDAIVNAANSRFLGCMQANHDC
    USA300_FPR3757  QDAMLSDLNRQHVTDLKDLKPIKGDNIFVWQGDITTLKIDAIVNAANSRFLGCMQANHDC
                    *********:**************************************************

    COL             IDNIIHTKAGVQVRLDCAEIIRQQGRNEGVGKAKITRGYNLSAKYIIHTVGPQIRRLPVS
    N315            IDNIIHTKAGVQVRLDCAEIIRQQGRNEGVGKAKKTRGYNLPAKYIIHTVGPQIRRLPVS
    NCTC8325        IDNIIHTKAGVQVRLDCAEIIRQQGRNEGVGKAKITRGYNLPAKYIIHTVGPQIRRLPVS
    Newman          IDNIIHTKAGVQVRLDCAEIIRQQGRNEGVGKAKITRGYNLSAKYIIHTVGPQIRRLPVS
    USA300_FPR3757  IDNIIHTKAGVQVRLDCAEIIRQQGRNEGVGKAKITRGYNLSAKYIIHTVGPQIRRLPVS
                    ********************************** ******.******************

    COL             KMNQDLLAKCYLSCLKLADQHSLNHVAFCCISTGVFAFPQDEAAEIAVRTVESYLKETNS
    N315            KMNQDLLAKCYLSCLKLADQHSLNHVAFCCISTGVFAFPQDEAAEIAVRTVESYLKETNS
    NCTC8325        KMNQDLLAKCYLSCLKLADQHSLNHVAFCCISTGVFAFPQDEAAEIAVRTVESYLKETNS
    Newman          KMNQDLLAKCYLSCLKLADQHSLNHVAFCCISTGVFAFPQDEAAEIAVRTVESYLKETNS
    USA300_FPR3757  KMNQDLLAKCYLSCLKLADQHSLNHVAFCCISTGVFAFPQDEAAEIAVRTVESYLKETNS
                    ************************************************************

    COL             TLKVVFNVFTDKDLQLYKEAFNRDAE
    N315            TLKVVFNVFTDKDLQLYKEALNRDAE
    NCTC8325        TLKVVFNVFTDKDLQLYKEAFNRDAE
    Newman          TLKVVFNVFTDKDLQLYKEAFNRDAE
    USA300_FPR3757  TLKVVFNVFTDKDLQLYKEAFNRDAE
                    ********************:*****