From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: saupan006372000
  • symbol?: manP
  • description?: fructose phosphotransferase system enzyme fruA-like protein

      descriptions from strain specific annotations:

    • fructose phosphotransferase system enzyme fruA-like protein
    • PTS system, fructose-specific IIABC components
    • PTS system, mannose-specific IIB component / PTS system, mannose-specific IIC component / PTS system, mannose-specific IIA component
    • PTS system, Fru family, IIB component domain protein
    • PTS system fructose subfamily transporter subunit IIC
    • phosphotransferase system, fructose-specific IIABC component
    • PTS family fructose/mannitol (fru) porter component IIABC
    • PTS system fructose-specific transporter subunit IIABC
    • PTS transport system, IIABC component
    • PTS system mannose-specific transporter subunit IIBCA
    • putative PTS transport system, IIABC component
    • PTS system fructose-specific II component
    • PTS system fructose/mannitol (fru) transporter subunit IIABC
    • PTS system mannose-specific transporter subunit IIAB
    • PTS transport system transporter subunit IIABC
  • strand?: +
  • coordinates?: 6408770..6410736
  • synteny block?: BlockID0050810
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2580 (fruA)
    08BA02176:
    C248_2709
    11819-97:
    MS7_2646 (manP)
    71193:
    ST398NM01_2691
    ECT-R 2:
    ECTR2_2495
    ED133:
    SAOV_2690
    ED98:
    SAAV_2711
    HO 5096 0412:
    SAEMRSA15_25460
    JH1:
    SaurJH1_2721
    JH9:
    SaurJH9_2665
    JKD6008:
    SAA6008_02700
    JKD6159:
    SAA6159_02537
    LGA251:
    SARLGA251_24130
    M013:
    M013TW_2622
    MRSA252:
    SAR2720
    MSHR1132:
    SAMSHR1132_24650
    MSSA476:
    SAS2527
    Mu3:
    SAHV_2625
    Mu50:
    SAV2641
    MW2:
    MW2562
    RF122:
    SAB2516
    ST398:
    SAPIG2691
    T0131:
    SAT0131_02907 (cna)
    TCH60:
    HMPREF0772_10546
    TW20:
    SATW20_27790
    USA300_TCH1516:
    USA300HOU_2641
    VC40:
    SAVC_12085

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKIVAITSCPNGIAHTYMAQEKLEQVAKEMGVDIKVETQGGVGAENVLTTQDIEEADGVI
    N315            MKIVAITSCPNGIAHTYMAQEKLEQVAKEMGVDIKVETQGGVGAENVLTTQDIEEADGVI
    NCTC8325        MKIVAITSCPNGIAHTYMAQEKLEQVAKEMGVDIKVETQGGVGAENVLTTQDIEEADGVI
    Newman          MKIVAITSCPNGIAHTYMAQEKLEQVAKEMGVDIKVETQGGVGAENVLTTQDIEEADGVI
    USA300_FPR3757  MKIVAITSCPNGIAHTYMAQEKLEQVAKEMGVDIKVETQGGVGAENVLTTQDIEEADGVI
                    ************************************************************

    COL             IAADKQVDLSRFVGKRLINENVREGIHNPRGLIQRIINQDAPIYQSETNYHSKDRGKSKS
    N315            IAADKQVDLSRFVGKRLINENVREGIHNPRGLIQRIINQDAPIYQSETNYHSKDRGKSKS
    NCTC8325        IAADKQVDLSRFVGKRLINENVREGIHNPRGLIQRIINQDAPIYQSETNYHSKDRGKSKN
    Newman          IAADKQVDLSRFVGKRLINENVREGIHNPRGLIQRIINQDAPIYQSETNYHSKDRGKSKS
    USA300_FPR3757  IAADKQVDLSRFVGKRLINENVREGIHNPRGLIQRIINQDAPIYQSETNYHSKDRGKSKS
                    ***********************************************************.

    COL             GIQMVYQHLMNGVSFMVPFIVVGGLLIAIALTLGGETTSKGLVIPDDSFWKSIENIGSLA
    N315            GIQMVYQHLMNGVSFMVPFIVVGGLLIAIALTLGGETTSKGLVIPDDSFWKSIENIGSLA
    NCTC8325        GIQMVYQHLMNGVSFMVPFIVVGGLLIAIALTLGGETTSKGLVIPDDSFWKSIENIGSLA
    Newman          GIQMVYQHLMNGVSFMVPFIVVGGLLIAIALTLGGETTSKGLVIPDDSFWKSIENIGSLA
    USA300_FPR3757  GIQMVYQHLMNGVSFMVPFIVVGGLLIAIALTLGGETTSKGLVIPDDSFWKSIENIGSLA
                    ************************************************************

    COL             FKFMVPILAGYIAVSIADKPGLVPGMIGGAIAADGSFYGSDAGAGFLGGIVAGFLAGYIA
    N315            FKFMVPILAGYIAVSIADKPGLVPGMIGGAIAADGSFYGSDAGAGFLGGIVAGFLAGYIA
    NCTC8325        FKFMVPILAGYIAVSIADKPGLVPGMIGGAIAADGSFYGSDAGAGFLGGIVAGFLAGYIA
    Newman          FKFMVPILAGYIAVSIADKPGLVPGMIGGAIAADGSFYGSDAGAGFLGGIVAGFLAGYIA
    USA300_FPR3757  FKFMVPILAGYIAVSIADKPGLVPGMIGGAIAADGSFYGSDAGAGFLGGIVAGFLAGYIA
                    ************************************************************

    COL             KWIKDIKVPKAMAPIMPIIIIPIISSVVVGLIFIFLIGAPISNIFEALTTWLKSMQGANI
    N315            KWIKDIKVPKAMAPIMPIIIIPIISSVVVGLIFIFLIGAPISNIFEALTTWLKSMQGANI
    NCTC8325        KWIKDIKVPKAMAPIMPIIIIPIISSVVVGLIFIFLIGAPISNIFEALTTWLKSMQGANI
    Newman          KWIKDIKVPKAMAPIMPIIIIPIISSVVVGLIFIFLIGAPISNIFEALTTWLKSMQGANI
    USA300_FPR3757  KWIKDIKVPKAMAPIMPIIIIPIISSVVVGLIFIFLIGAPISNIFEALTTWLKSMQGANI
                    ************************************************************

    COL             IILAMIIGAMIAFDMGGPVNKVAFLFGSALIAEGNYAVMGMVAVAVCTPPIGLGLATFVQ
    N315            IILAMIIGAMIAFDMGGPVNKVAFLFGSALIAEGNYAVMGMVAVAVCTPPIGLGLATFVQ
    NCTC8325        IILAMIIGAMIAFDMGGPVNKVAFLFGSALIAEGNYAVMGMVAVAVCTPPIGLGLATFVQ
    Newman          IILAMIIGAMIAFDMGGPVNKVAFLFGSALIAEGNYAVMGMVAVAVCTPPIGLGLATFVQ
    USA300_FPR3757  IILAMIIGAMIAFDMGGPVNKVAFLFGSALIAEGNYAVMGMVAVAVCTPPIGLGLATFVQ
                    ************************************************************

    COL             KYKFNHSEREMGKASFTMGLFGITEGAIPFAAQDPLRIIPANIIGAMIASVIAAIGGVGD
    N315            KYKFNHSEREMGKASFTMGLFGITEGAIPFAAQDPLRIIPANIIGAMIASVIAAIGGVGD
    NCTC8325        KYKFNHSEREMGKASFTMGLFGITEGAIPFAAQDPLRIIPANIIGAMIASVIAAIGGVGD
    Newman          KYKFNHSEREMGKASFTMGLFGITEGAIPFAAQDPLRIIPANIIGAMIASVIAAIGGVGD
    USA300_FPR3757  KYKFNHSEREMGKASFTMGLFGITEGAIPFAAQDPLRIIPANIIGAMIASVIAAIGGVGD
                    ************************************************************

    COL             RVAHGGPIVAVLGGIDHVLWFIFAVIVGSLVTMTTVLLLKRNTPVIAVDAPAQHTQLHDT
    N315            RVAHGGPIVAVLGGIDHVLWFIFAVIVGSLVTMTTVLLLKRNTPVIAVDAPAQHTQLHDT
    NCTC8325        RVAHGGPIVAVLGGIDHVLWFIFAVIVGSLVTMTTVLLLKRNTPVIAVDAPAQHTQLHDT
    Newman          RVAHGGPIVAVLGGIDHVLWFIFAVIVGSLVTMTTVLLLKRNTPVIAVDAPAQHTQLHDT
    USA300_FPR3757  RVAHGGPIVAVLGGIDHVLWFIFAVIVGSLVTMTTVLLLKRNTPVIAVDAPAQHTQLHDT
                    ************************************************************

    COL             DITQHDTEVDNVDNTAKHSHLNKPSHVFDQQTMIITDHDMSRNEAIDMLIHKLKICRYVE
    N315            DITQHDTEVDNVDKTAKHSHLNKPSHVFDQQTMIITDHDMSRNEAIDMLIHKLKICRYVE
    NCTC8325        DITQHDTEVDNVDNTAKHSHLNKPSHVFDQQTMIITDHDMSRNEAIDMLIHKLKICRYVE
    Newman          DITQHDTEVDNVDNTAKHSHLNKPSHVFDQQTMIITDHDMSRNEAIDMLIHKLKICRYVE
    USA300_FPR3757  DITQHDTEVDNVDNTAKHSHLNKPSHVFDQQTMIITDHDMSRNEAIDMLIHKLKICRYVE
                    *************:**********************************************

    COL             HTSHLKNAILEREMESTTAIGMNVAIPHAKSDVVKQPIVAVMKNNHGVKWDSLDGSLPQL
    N315            HTSHLKNAILEREMESTTAIGMNVAIPHAKSDVVKQPIVAVMKNNHGVKWDSLDGSLPQL
    NCTC8325        HTSHLKNAILEREMESTTAIGMNVAIPHAKSDVVKQPIVAVMKNNHGVKWDSLDGSLPQL
    Newman          HTSHLKNAILEREMESTTAIGMNVAIPHAKSDVVKQPIVAVMKNNHGVKWDSLDGSLPQL
    USA300_FPR3757  HTSHLKNAILEREMGSTTAIGMNVAIPHAKSDVVKQPIVAVMKNNHGVKWDSLDGSLPQL
                    ************** *********************************************

    COL             IFLIAVPNNSQDTHLKILQRLSKALMNDETRQSLINANSTTEIYNLLMKI
    N315            IFLIAVPNNSQDTHLKILQRLSKALMNDETRQSLINANSTTEIYNLLMKI
    NCTC8325        IFLIAVPNNSQDTHLKILQRLSKALMNDETRQSLINANSTTEIYNLLMKI
    Newman          IFLIAVPNNSQDTHLKILQRLSKALMNDETRQSLINANSTTEIYNLLMKI
    USA300_FPR3757  IFLIAVPNNSQDTHLKILQRLSKALMNDETRQSLINANSTTEIYNLLMKI
                    **************************************************