From AureoWiki
Jump to navigation Jump to search

NCBI: 22-FEB-2026

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_RS13125 [old locus tag: EGJ38_002629 ]
  • pan locus tag?: SAUPAN006370000
  • symbol: EGJ38_RS13125
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_RS13125 [old locus tag: EGJ38_002629 ]
  • symbol: EGJ38_RS13125
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2635144..2635602
  • length: 459
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NZ_CM129921 (2635144..2635602) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    TTGAAAAAACTTCTTATTACCATCGTAATTATCGTATTAATCGGAGCACTTGGGTTCGCA
    ATTTATGCTGCAATAAATCATTCTACATCATCAAGTAATAACCAAGAACAAGAAAATAAA
    GCTACGCATAAAAAGACAGAAACCGAAGAAAATGATCAACAAGATGATAGTGCAAACAAA
    GCAGATAAAAATCAAAATAATGGCAATAACGATACTAATGACAATCAACCATCTTCACCG
    TCAAATGTTCCTAACAACCATTCAACAGTACCATCGAATACGCAACCAGCTCAGCCAAAA
    GACTCAAATTCAAATAAAAATAATACTCACGATGGTGGCAGTCAATCGTCAACAAACAAC
    CAAAATAATCAACAACAGAACACACCACCTGCTAATAAATCAAATAATACCAATACGCCT
    TCTAAACAAACACCTCAAGCACAATCACCTAAAAATTAA
    60
    120
    180
    240
    300
    360
    420
    459

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_RS13125 [old locus tag: EGJ38_002629 ]
  • symbol: EGJ38_RS13125
  • description: hypothetical protein
  • length: 152
  • theoretical pI: 6.97047
  • theoretical MW: 16388.2
  • GRAVY: -1.50329

Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Cell division cell division protein ZipA (TIGR02205; HMM-score: 19.9)
    and 11 more
    Metabolism Transport and binding proteins Cations and iron carrying compounds cation transporter family protein (TIGR00860; HMM-score: 14.8)
    heavy metal sensor kinase (TIGR01386; EC 2.7.13.3; HMM-score: 13)
    Metabolism Energy metabolism Electron transport sulfocyanin (TIGR03094; HMM-score: 12.2)
    Genetic information processing Transcription Degradation of RNA ribonuclease Y (TIGR03319; EC 3.1.-.-; HMM-score: 12.1)
    Genetic information processing Mobile and extrachromosomal element functions Plasmid functions entry exclusion protein TrbK (TIGR04361; HMM-score: 11.3)
    two transmembrane protein (TIGR04527; HMM-score: 11.1)
    mycoides cluster lipoprotein, LppA/P72 family (TIGR03490; HMM-score: 9.9)
    Cellular processes Cellular processes Pathogenesis putative immunoglobulin-blocking virulence protein (TIGR04526; HMM-score: 8.6)
    Cellular processes Cellular processes Sporulation and germination stage III sporulation protein AG (TIGR02830; HMM-score: 7.3)
    Metabolism Transport and binding proteins Cations and iron carrying compounds potassium uptake protein, Trk family (TIGR00934; HMM-score: 5.5)
    Metabolism Transport and binding proteins Nucleosides, purines and pyrimidines nucleoside Transporter (TIGR00939; HMM-score: 4.6)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    no clan defined DUF4834; Domain of unknown function (DUF4834) (PF16118; HMM-score: 20.9)
    DUF4083; Domain of unknown function (DUF4083) (PF13314; HMM-score: 18.5)
    and 16 more
    SARAF; SOCE-associated regulatory factor of calcium homoeostasis (PF06682; HMM-score: 15.5)
    TSPAN_4TM-like (CL0347) Tetraspanin; Tetraspanin family (PF00335; HMM-score: 14.3)
    no clan defined PsaL; Photosystem I reaction centre subunit XI (PF02605; HMM-score: 12.3)
    UPF0767; UPF0767 family (PF15990; HMM-score: 12.2)
    FeoB_associated; FeoB-associated Cys-rich membrane protein (PF12669; HMM-score: 11.8)
    Transporter (CL0375) Connexin; Connexin (PF00029; HMM-score: 10.6)
    Peptidase_AD (CL0130) Presenilin; Presenilin (PF01080; HMM-score: 10.6)
    DMT (CL0184) TMEM144; Transmembrane family, TMEM144 of transporters (PF07857; HMM-score: 10.5)
    no clan defined Gastrin; Gastrin/cholecystokinin family (PF00918; HMM-score: 8.2)
    TSPAN_4TM-like (CL0347) DUF4064; Protein of unknown function (DUF4064) (PF13273; HMM-score: 7.7)
    GT-B (CL0113) FUT8_N_cat; Alpha-(1,6)-fucosyltransferase N- and catalytic domains (PF19745; HMM-score: 7.2)
    no clan defined CD34_antigen; CD34/Podocalyxin family (PF06365; HMM-score: 7)
    FAM176; FAM176 family (PF14851; HMM-score: 7)
    RBM_T3SS-Flag (CL0873) SpoIIIAH; SpoIIIAH-like protein (PF12685; HMM-score: 6.9)
    GPCR_A (CL0192) SID-1_RNA_chan; dsRNA-gated channel SID-1 (PF13965; HMM-score: 6.8)
    no clan defined DUF6080; Family of unknown function (DUF6080) (PF19558; HMM-score: 6.6)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.05
    • Cellwall Score: 0.82
    • Extracellular Score: 9.13
    • Internal Helix: 1
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.4245
    • Cell wall & surface Score: 0.0015
    • Extracellular Score: 0.574
  • LocateP:
  • SignalP: Signal peptide SP(Sec/SPI) length 23 aa
    • SP(Sec/SPI): 0.901574
    • TAT(Tat/SPI): 0.001978
    • LIPO(Sec/SPII): 0.077133
    • Cleavage Site: CS pos: 23-24. IYA-AI. Pr: 0.4479
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: WP_000734797 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MKKLLITIVIIVLIGALGFAIYAAINHSTSSSNNQEQENKATHKKTETEENDQQDDSANKADKNQNNGNNDTNDNQPSSPSNVPNNHSTVPSNTQPAQPKDSNSNKNNTHDGGSQSSTNNQNNQQQNTPPANKSNNTNTPSKQTPQAQSPKN

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]