Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL_RS04355 [old locus tag: SACOL0847 ]
- pan locus tag?: SAUPAN002715000
- symbol: SACOL_RS04355
- pan gene symbol?: smpB
- synonym:
- product: SsrA-binding protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL_RS04355 [old locus tag: SACOL0847 ]
- symbol: SACOL_RS04355
- product: SsrA-binding protein
- replicon: chromosome
- strand: +
- coordinates: 875400..875864
- length: 465
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_002951 (875400..875864) NCBI
- BioCyc: SACOL_RS04355 BioCyc
- MicrobesOnline: see SACOL0847
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGGCTAAGAAGAAATCACCAGGTACATTAGCGGAAAATCGTAAGGCAAGACATGATTAT
AATATTGAAGATACGATTGAAGCGGGAATTGTATTGCAAGGCACAGAAATAAAATCAATT
CGCCGAGGTAGTGCTAACCTTAAAGATAGTTATGCGCAAGTTAAAAACGGTGAAATGTAT
TTGAATAATATGCATATAGCACCATACGAAGAAGGGAATCGTTTTAATCACGATCCTCTT
CGTTCTCGAAAATTATTATTGCACAAGCGTGAAATCATTAAATTGGGTGATCAAACACGT
GAGATTGGTTATTCGATTGTGCCGTTAAAGCTTTATTTGAAGCATGGACATTGTAAAGTA
TTACTTGGTGTTGCACGAGGTAAGAAAAAATATGATAAACGTCAAGCTTTGAAAGAAAAA
GCAGTCAAACGAGATGTTGCGCGCGATATGAAAGCCCGTTATTAA60
120
180
240
300
360
420
465
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL_RS04355 [old locus tag: SACOL0847 ]
- symbol: SACOL_RS04355
- description: SsrA-binding protein
- length: 154
- theoretical pI: 10.6419
- theoretical MW: 17755.5
- GRAVY: -0.857143
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Other SsrA-binding protein (TIGR00086; HMM-score: 194.9)
- TheSEED: see SACOL0847
- PFAM: no clan defined SmpB; SmpB protein (PF01668; HMM-score: 208.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.7938
- Cytoplasmic Membrane Score: 0.0001
- Cell wall & surface Score: 0
- Extracellular Score: 0.206
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.006512
- TAT(Tat/SPI): 0.002664
- LIPO(Sec/SPII): 0.000793
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MAKKKSPGTLAENRKARHDYNIEDTIEAGIVLQGTEIKSIRRGSANLKDSYAQVKNGEMYLNNMHIAPYEEGNRFNHDPLRSRKLLLHKREIIKLGDQTREIGYSIVPLKLYLKHGHCKVLLGVARGKKKYDKRQALKEKAVKRDVARDMKARY
⊟Experimental data[edit | edit source]
- experimentally validated: see SACOL0847
- protein localization: see SACOL0847
- quantitative data / protein copy number per cell: see SACOL0847
- interaction partners:
SACOL_RS01040 formate acetyltransferase [1] (data from MRSA252) SACOL_RS01530 5'-nucleotidase, lipoprotein e(P4) family [1] (data from MRSA252) SACOL_RS02200 30S ribosomal protein S6 [1] (data from MRSA252) SACOL_RS02210 30S ribosomal protein S18 [1] (data from MRSA252) SACOL_RS02825 RNA-binding protein S1 [1] (data from MRSA252) SACOL_RS03025 50S ribosomal protein L11 [1] (data from MRSA252) SACOL_RS03030 50S ribosomal protein L1 [1] (data from MRSA252) SACOL_RS03035 50S ribosomal protein L10 [1] (data from MRSA252) SACOL_RS03040 50S ribosomal protein L7/L12 [1] (data from MRSA252) SACOL_RS03055 DNA-directed RNA polymerase subunit beta' [1] (data from MRSA252) SACOL_RS03065 30S ribosomal protein S12 [1] (data from MRSA252) SACOL_RS03070 30S ribosomal protein S7 [1] (data from MRSA252) SACOL_RS03075 elongation factor G [1] (data from MRSA252) SACOL_RS03080 elongation factor Tu [1] (data from MRSA252) SACOL_RS03540 metal ABC transporter substrate-binding protein [1] (data from MRSA252) SACOL_RS03755 LysR family transcriptional regulator [1] (data from MRSA252) SACOL_RS04310 aldehyde dehydrogenase [1] (data from MRSA252) SACOL_RS05415 bifunctional autolysin [1] (data from MRSA252) SACOL_RS05605 ribonuclease J 1 [1] (data from MRSA252) SACOL_RS06295 16S rRNA (cytosine(967)-C(5))-methyltransferase [1] (data from MRSA252) SACOL_RS06420 50S ribosomal protein L19 [1] (data from MRSA252) SACOL_RS06575 translation initiation factor IF-2 [1] (data from MRSA252) SACOL_RS06595 30S ribosomal protein S15 [1] (data from MRSA252) SACOL_RS06605 ribonuclease J 2 [1] (data from MRSA252) SACOL_RS07705 DNA-binding protein HU [1] (data from MRSA252) SACOL_RS08615 bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase [1] (data from MRSA252) SACOL_RS08680 50S ribosomal protein L21 [1] (data from MRSA252) SACOL_RS08795 trigger factor [1] (data from MRSA252) SACOL_RS08820 50S ribosomal protein L20 [1] (data from MRSA252) SACOL_RS08825 50S ribosomal protein L35 [1] (data from MRSA252) SACOL_RS08830 translation initiation factor IF-3 [1] (data from MRSA252) SACOL_RS08970 universal stress protein [1] (data from MRSA252) SACOL_RS09045 30S ribosomal protein S4 [1] (data from MRSA252) SACOL_RS09095 serine protease [1] (data from MRSA252) SACOL_RS11050 50S ribosomal protein L31 type B [1] (data from MRSA252) SACOL_RS11615 30S ribosomal protein S9 [1] (data from MRSA252) SACOL_RS11645 50S ribosomal protein L17 [1] (data from MRSA252) SACOL_RS11655 30S ribosomal protein S11 [1] (data from MRSA252) SACOL_RS11660 30S ribosomal protein S13 [1] (data from MRSA252) SACOL_RS11685 50S ribosomal protein L15 [1] (data from MRSA252) SACOL_RS11695 30S ribosomal protein S5 [1] (data from MRSA252) SACOL_RS11700 50S ribosomal protein L18 [1] (data from MRSA252) SACOL_RS11705 50S ribosomal protein L6 [1] (data from MRSA252) SACOL_RS11720 50S ribosomal protein L5 [1] (data from MRSA252) SACOL_RS11735 30S ribosomal protein S17 [1] (data from MRSA252) SACOL_RS11745 50S ribosomal protein L16 [1] (data from MRSA252) SACOL_RS11750 30S ribosomal protein S3 [1] (data from MRSA252) SACOL_RS11755 50S ribosomal protein L22 [1] (data from MRSA252) SACOL_RS11760 30S ribosomal protein S19 [1] (data from MRSA252) SACOL_RS11765 50S ribosomal protein L2 [1] (data from MRSA252) SACOL_RS11770 50S ribosomal protein L23 [1] (data from MRSA252) SACOL_RS11775 50S ribosomal protein L4 [1] (data from MRSA252) SACOL_RS11780 50S ribosomal protein L3 [1] (data from MRSA252) SACOL_RS13725 malate:quinone oxidoreductase [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 1.38 1.39 1.40 1.41 1.42 1.43 1.44 1.45 1.46 1.47 1.48 1.49 1.50 1.51 1.52 1.53 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)