From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_0765 [new locus tag: SAUSA300_RS04125 ]
  • pan locus tag?: SAUPAN002715000
  • symbol: smpB
  • pan gene symbol?: smpB
  • synonym:
  • product: SsrA-binding protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_0765 [new locus tag: SAUSA300_RS04125 ]
  • symbol: smpB
  • product: SsrA-binding protein
  • replicon: chromosome
  • strand: +
  • coordinates: 853905..854369
  • length: 465
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGGCTAAGAAGAAATCACCAGGTACATTAGCGGAAAATCGTAAGGCAAGACATGATTAT
    AATATTGAAGATACGATTGAAGCGGGAATTGTATTGCAAGGCACAGAAATAAAATCAATT
    CGCCGAGGTAGTGCTAACCTTAAAGATAGTTATGCGCAAGTTAAAAACGGTGAAATGTAT
    TTGAATAATATGCATATAGCACCATACGAAGAAGGGAATCGTTTTAATCACGATCCTCTT
    CGTTCTCGAAAATTATTATTGCACAAGCGTGAAATCATTAAATTGGGTGATCAAACACGT
    GAGATTGGTTATTCGATTGTGCCGTTAAAGCTTTATTTGAAGCATGGACATTGTAAAGTA
    TTACTTGGTGTTGCACGAGGTAAGAAAAAATATGATAAACGTCAAGCTTTGAAAGAAAAA
    GCAGTCAAACGAGATGTTGCGCGCGATATGAAAGCCCGTTATTAA
    60
    120
    180
    240
    300
    360
    420
    465


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_0765 [new locus tag: SAUSA300_RS04125 ]
  • symbol: SmpB
  • description: SsrA-binding protein
  • length: 154
  • theoretical pI: 10.6419
  • theoretical MW: 17755.5
  • GRAVY: -0.857143

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis Other SsrA-binding protein (TIGR00086; HMM-score: 194.9)
  • TheSEED  :
    • tmRNA-binding protein SmpB
    Phages, Prophages, Transposable elements, Plasmids Pathogenicity islands Staphylococcal pathogenicity islands SaPI  tmRNA-binding protein SmpB
    and 3 more
    Protein Metabolism Protein biosynthesis Trans-translation by stalled ribosomes  tmRNA-binding protein SmpB
    Protein Metabolism Protein biosynthesis Translation termination factors bacterial  tmRNA-binding protein SmpB
    Stress Response Heat shock Heat shock dnaK gene cluster extended  tmRNA-binding protein SmpB
  • PFAM:
    no clan defined SmpB; SmpB protein (PF01668; HMM-score: 208.3)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.7938
    • Cytoplasmic Membrane Score: 0.0001
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.206
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.006512
    • TAT(Tat/SPI): 0.002664
    • LIPO(Sec/SPII): 0.000793
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MAKKKSPGTLAENRKARHDYNIEDTIEAGIVLQGTEIKSIRRGSANLKDSYAQVKNGEMYLNNMHIAPYEEGNRFNHDPLRSRKLLLHKREIIKLGDQTREIGYSIVPLKLYLKHGHCKVLLGVARGKKKYDKRQALKEKAVKRDVARDMKARY

Experimental data[edit | edit source]

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 1.38 1.39 1.40 1.41 1.42 1.43 1.44 1.45 1.46 1.47 1.48 1.49 1.50 1.51 1.52 1.53 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]